2OZU: Human MYST histone acetyltransferase 3

Name: PDB 2OZU: Crystal structure of human MYST histone acetyltransferase 3 in complex with acetylcoenzyme A
Published: 2007-03-13
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transferase

Crystal structure of human MYST histone acetyltransferase 3 in complex with acetylcoenzyme A. Determined by X-ray diffraction at 2.3 Å resolution. Released 13 Mar 2007.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,339
Mol. weight: 34.63 kDa
Ligands: ACM, ACO, ZN
Released: 13 Mar 2007

Explore 2OZU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2OZU contains 10 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	511-514	4	1
β-strand	517-520	4	1
β-strand	536-539	4	1
β-strand	546-547	2	1
α-helix	550-559	10
β-strand	568-573	6	2
β-strand	576-582	7	2
α-helix	587-598	12
β-strand	613-622	10	2
β-strand	625-635	11	2
β-strand	642-644	3	3
β-strand	646-649	4	2
α-helix	651-653	3
α-helix	658-672	15
β-strand	677	1	4
β-strand	678-679	2	3
α-helix	683-684	2
α-helix	685-705	21
α-helix	713-720	8
β-strand	722	1	4
α-helix	724-733	10
α-helix	750-759	10
α-helix	771-773	3
β-strand	774	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Histone acetyltransferase MYST3	A	protein	284	Homo sapiens	Q92794 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2OZU_1 Histone acetyltransferase MYST3 (chains A)
GVTGPPDPQVRCPSVIEFGKYEIHTWYSSPYPQEYSRLPKLYLCEFCLKYMKSRTILQQH
MKKCGWFHPPANEIYRKNNISVFEVDGNVSTIYCQNLCLLAKLFLDHKTLYYDVEPFLFY
VLTQNDVKGCHLVGYFSKEKHCQQKYNVSCIMILPQYQRKGYGRFLIDFSYLLSKREGQA
GSPEKPLSDLGRLSYMAYWKSVILECLYHQNDKQISIKKLSKLTGICPQDITSTLHHLRM
LDFRSDQFVIIRREKLIQDHMAKLQLNLRPVDVDPECLRWTPVI

Ligands and cofactors

ID	Name	Formula	Copies
ACM	Acetamide	C2 H5 N O	4
ACO	Acetyl coenzyme *a	C23 H38 N7 O17 P3 S	1
ZN	Zinc ion	Zn	1

Primary citation

The crystal structure of human MYST histone acetyltransferase 3 in complex with acetylcoenzyme A. Wu, H., Min, J., Dombrovski, L. et al. To be published.

Other PDB entries of the same protein (UniProt Q92794 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5B78 1.4 Å, Crystal structure of MOZ double PHD finger mutant-S210D/N235R in complex with histone H3…
3V43 1.47 Å, Crystal structure of MOZ
7Y43 1.5 Å, Crystal structure of the KAT6A WH domain and its bound double stranded DNA
5B77 1.55 Å, Crystal structrue of MOZ double PHD finger in complex with histone H3 propionylation at…
4LK9 1.6 Å, Crystal Structure of MOZ double PHD finger histone H3 tail complex
4LKA 1.61 Å, Crystal Structure of MOZ double PHD finger histone H3K9ac complex
5B76 1.65 Å, Crystal structure of MOZ double PHD finger domain in complex with histone H3…
5B75 1.7 Å, Crystal structure of MOZ double PHD finger in complex with histone H3 butyrylation at K14
9DZN 1.72 Å, KAT6A MYST domain complexed with a H3K14-CoA bisubstrate inhibitor
8H7A 1.92 Å, Crystal structure of the dimer form KAT6A WH domain with its bound double stranded DNA
6LSB 2.0 Å, Crystal Structure of DPF domain of MOZ in complex with H3K14bz peptide
9ARR 2.1 Å, Crystal structure of AF9 YEATS domain in complex with dicrotonylated at K1007 and K1014…

Browse structure collections

About this viewer

MolViewer shows 2OZU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.