2P03: Receptor-associated protein(RAP)

The structure of receptor-associated protein(RAP). Determined by solution NMR. Released 21 Aug 2007.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 2,666
Mol. weight: 37.85 kDa
Released: 21 Aug 2007

Explore 2P03 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2P03 contains 10 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	23-35	13
α-helix	39-65	27
α-helix	72-88	17
α-helix	115-127	13
α-helix	133-161	29
α-helix	184-209	26
α-helix	223-230	8
α-helix	237-274	38
α-helix	275-277	3
α-helix	283-315	33

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Alpha-2-macroglobulin receptor-associated protein	A	protein	323	Homo sapiens	P30533 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2P03_1 Alpha-2-macroglobulin receptor-associated protein (chains A)
YSREKNQPKPSPKRESGEEFRMEKLNQLWEKAQRLHLPPVRLAELHADLKIQERDELAWK
KLKLDGLDEDGEKEARLIRNLNVILAKYGLDGKKDARQVTSNSLSGTQEDGLDDPRLEKL
WHKAKTSGKFSGEELDKLWREFLHHKEKVHEYNVLLETLSRTEEIHENVISPSDLSDIKG
SVLHSRHTELKEKLRSINQGLDRLRRVSHQGYSTEAEFEEPRVIDLWDLAQSANLTDKEL
EAFREELKHFEAKIEKHNHYQKQLEIAHEKLRHAESVGDGERVSRSREKHALLEGRTKEL
GYTVKKHLQDLSGRISRARHNEL

Primary citation

The structure of receptor-associated protein (RAP). Lee, D., Walsh, J.D., Migliorini, M. et al. Protein Sci (2007) 16:1628-1640. DOI 10.1110/ps.072865407 · PubMed

Other PDB entries of the same protein (UniProt P30533 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2FCW 1.26 Å, Structure of a Complex Between the Pair of the LDL Receptor Ligand-Binding Modules 3-4…
9QAW 3.34 Å, CryoEM structure of the human LRP2 receptor ectodomain in complex with LRPAP1
1LRE Receptor associated protein (RAP) domain 1, NMR, 20 structures
1NRE Receptor associated protein (RAP) domain 1, NMR, minimized average structure
1OP1 Solution NMR structure of domain 1 of receptor associated protein
1OV2 Ensemble of the solution structures of domain one of receptor associated protein
2FTU solution structure of domain 3 of RAP
2FYL Haddock model of the complex between double module of LRP, CR56, and first domain of…
2P01 The structure of receptor-associated protein(RAP)

Browse structure collections

About this viewer

MolViewer shows 2P03 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.