2P24: I-Au/MBP125-135

I-Au/MBP125-135. Determined by X-ray diffraction at 2.15 Å resolution. Released 15 Jan 2008.

Method: X-ray diffraction
Resolution: 2.15 Å
Organism: Mus musculus
Chains: 2
Atoms: 3,203
Mol. weight: 56.1 kDa
Released: 15 Jan 2008

Explore 2P24 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2P24 contains 13 α-helices and 30 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	5-15	12	1
β-strand	19-26	8	1
β-strand	29-35	7	1
β-strand	40-43	4	1
α-helix	48-50	3
β-strand	53	1	2
α-helix	57-76	20
α-helix	80-84	5
β-strand	88-93	6	3
β-strand	103-112	10	3
β-strand	118-123	6	4
β-strand	126-128	3	4
β-strand	132-134	3	3
α-helix	137	1
β-strand	138-139	2	3
β-strand	145-153	9	3
β-strand	161-166	6	4
β-strand	174-178	5	4

Chain B: 9 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	0	1	2
α-helix	3-9	7
β-strand	107-118	12	1
β-strand	123-132	10	1
β-strand	135-141	7	1
β-strand	146-149	4	1
α-helix	152-154	3
α-helix	158-164	7
α-helix	168-174	7
α-helix	175-180	6
α-helix	181-182	2
α-helix	183-186	5
β-strand	195	1	5
α-helix	196-197	2
β-strand	198-203	6	6
β-strand	214-222	9	6
β-strand	223	1	5
β-strand	228-233	6	7
β-strand	236-238	3	7
β-strand	242-244	3	6
α-helix	245-247	3
β-strand	248-249	2	6
β-strand	255-262	8	6
β-strand	270-276	7	7
β-strand	284-289	6	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
H-2 class II histocompatibility antigen, A-U alpha chain	A	protein	236	Mus musculus	P14438 (AlphaFold model)
H-2 class II histocompatibility antigen, A-U beta chain	B	protein	259	Mus musculus	P06344 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2P24_1 H-2 class II histocompatibility antigen, A-U alpha chain (chains A)
MAIMAPRTLVLLLSGALALTQTWAGSHSRGEDDIEADHVGSYGIVVYQSPGDIGQYTFEF
DGDELFYVDLDKKETIWMLPEFAQLRSFDPQGGLQNIATGKHNLGVLTKRSNSTPATNEA
PQATVFPKSPVLLGQPNTLICFVDNIFPPVINITWLRNSKSVADGVYETSFFVNRDYSFH
KLSYLTFIPSDDDIYDCKVEHWGLEEPVLKHWEPEIPAPMSELTETSGSRLEVLFQ

Sequence of entity 2 (B), FASTA

>2P24_2 H-2 class II histocompatibility antigen, A-U beta chain (chains B)
MAIMAPRTLVLLLSGALALTQTWAGSHSRGYGGRASDYKSAHKGGTGSGSGSGDSERHFV
VQFQPFCYFTNGTQRIRYVTRYIYNREEYLRFDSDVGEYRAVTELGRPDAEYYNKQYLER
TRAELDTVCRYNYEETEVPTSLRRLEQPNVVISLSRTEALNHHNTLVCSVTDFYPAKIKV
RWFRNGQEETVGVSSTQLIRNGDWTFQVLVMLEMTPRRGEVYTCHVEHPSLKSPITVEWR
AQSESARSKSGSRLEVLFQ

Primary citation

A new twist in TCR diversity revealed by a forbidden alphabeta TCR. McBeth, C., Seamons, A., Pizarro, J.C. et al. J Mol Biol (2008) 375:1306-1319. DOI 10.1016/j.jmb.2007.11.020 · PubMed

Other PDB entries of the same protein (UniProt P14438 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1K2D 2.2 Å, Crystal structure of the autoimmune MHC class II I-Au complexed with myelin basic…
2PXY 2.23 Å, Crystal structures of immune receptor complexes
1U3H 2.42 Å, Crystal structure of mouse TCR 172.10 complexed with MHC class II I-Au molecule at 2.4 A
2Z31 2.7 Å, Crystal structure of immune receptor complex

Browse structure collections

About this viewer

MolViewer shows 2P24 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.