2P45: Ribonuclease pancreatic

Complex of a camelid single-domain vhh antibody fragment with RNASE A at 1.1A resolution: SE5B-ORTHO-1 crystal form with five se-met sites (L4M, M34, M51, F68M, M83) in vhh scaffold. Determined by X-ray diffraction at 1.1 Å resolution. Released 11 Mar 2008.

Method: X-ray diffraction
Resolution: 1.1 Å
Organisms: Bos taurus, Camelus dromedarius
Chains: 2
Atoms: 2,212
Mol. weight: 27.24 kDa
Released: 11 Mar 2008

Explore 2P45 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2P45 contains 6 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	4-12	9
β-strand	13	1	1
α-helix	25-32	8
β-strand	43-47	5	1
α-helix	51-56	6
α-helix	57-59	3
β-strand	61-63	3	2
β-strand	72-74	3	2
β-strand	79-86	8	1
β-strand	91	1	3
β-strand	94	1	3
β-strand	97-104	8	1
β-strand	106-111	6	2
β-strand	116-123	8	2

Chain B: 2 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	4
β-strand	10-13	4	5
β-strand	18-25	8	4
β-strand	33-39	7	5
β-strand	46-52	7	5
β-strand	59-60	2	5
β-strand	65	1	4
β-strand	68-71	4	4
β-strand	78-83	6	4
α-helix	88-90	3
β-strand	92-98	7	5
α-helix	105-107	3
β-strand	110-111	2	5
β-strand	115-120	6	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ribonuclease pancreatic	A	protein	124	Bos taurus	P61823 (AlphaFold model)
Antibody cab-RN05	B	protein	123	Camelus dromedarius

Sequence of entity 1 (A), FASTA

>2P45_1 Ribonuclease pancreatic (chains A)
KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQ
KNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHF
DASV

Sequence of entity 2 (B), FASTA

>2P45_2 ANTIBODY CAB-RN05 (chains B)
GSQVQMVESGGGLVQAGGSLRLSCAASGYAYTYIYMGWFRQAPGKEREGVAAMDSGGGGT
LYADSVKGRMTISRDKGKNTVYLQMDSLKPEDTATYYCAAGGYELRDRTYGQWGQGTQVT
VSS

Primary citation

Toward chaperone-assisted crystallography: protein engineering enhancement of crystal packing and X-ray phasing capabilities of a camelid single-domain antibody (VHH) scaffold. Tereshko, V., Uysal, S., Koide, A. et al. Protein Sci (2008) 17:1175-1187. DOI 10.1110/ps.034892.108 · PubMed

Other PDB entries of the same protein (UniProt P61823 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6ETK 0.85 Å, Atomic resolution structure of RNase A (data collection 1)
6ETL 0.85 Å, Atomic resolution structure of RNase A (data collection 2)
7P4R 0.85 Å, Ultra High Resolution X-ray Structure of Orthorhombic Bovine Pancreatic Ribonuclease at…
1DY5 0.87 Å, Deamidated derivative of bovine pancreatic ribonuclease
6ETM 0.92 Å, Atomic resolution structure of RNase A (data collection 3)
6ETN 0.92 Å, Atomic resolution structure of RNase A (data collection 4)
6ETO 1.02 Å, Atomic resolution structure of RNase A (data collection 5)
6ETP 1.02 Å, Atomic resolution structure of RNase A (data collection 6)
1KF3 1.05 Å, Atomic Resolution Structure of RNase A at pH 5.9
2E3W 1.05 Å, X-ray structure of native RNase A
6ETQ 1.08 Å, Atomic resolution structure of RNase A (data collection 7)
1KF2 1.1 Å, Atomic Resolution Structure of RNase A at pH 5.2

Browse structure collections

About this viewer

MolViewer shows 2P45 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.