2P64: D domain of b-TrCP

D domain of b-TrCP. Determined by X-ray diffraction at 2.5 Å resolution. Released 19 Jun 2007.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 2
Atoms: 890
Mol. weight: 12.76 kDa
Ligands: CD
Released: 19 Jun 2007

Explore 2P64 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2P64 contains 9 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	129-141	13
α-helix	146-158	13
α-helix	162-172	11
α-helix	173-175	3

Chain B: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	127-129	3
α-helix	130-141	12
α-helix	146-158	13
α-helix	162-172	11
α-helix	173-176	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
F-box/WD repeat protein 1A	A, B	protein	52	Homo sapiens	Q9Y297 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2P64_1 F-box/WD repeat protein 1A (chains A, B)
GAASYEKEKELCVKYFEQWSESDQVEFVEHLISQMCHYQHGHINSYLKPMLQ

Ligands and cofactors

ID	Name	Formula	Copies
CD	Cadmium ion	Cd	1

Primary citation

Suprafacial orientation of the SCFCdc4 dimer accommodates multiple geometries for substrate ubiquitination. Tang, X., Orlicky, S., Lin, Z. et al. Cell (2007) 129:1165-1176. DOI 10.1016/j.cell.2007.04.042 · PubMed

Other PDB entries of the same protein (UniProt Q9Y297 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9T9W 1.16 Å, Crystal structure of beta-TrCP bound by diphosphorylated I-kappa-B-alpha degron peptide
9TES 1.22 Å, Crystal structure of beta-TrCP bound by diphosphorylated PDCD4 degron peptide
9TDZ 1.35 Å, Crystal structure of beta-TrCP bound by diphosphorylated claspin degron peptide
9TG7 1.68 Å, Crystal structure of beta-TrCP bound by monophosphorylated WEE1 degron peptide
9T8Y 1.79 Å, Crystal structure of beta-TrCP bound by monophosphorylated NRF2 degron peptide.
9TFU 2.0 Å, Crystal structure of beta-TrCP bound by monophosphorylated ATF4 degron peptide
6M90 2.05 Å, Monophosphorylated pSer33 b-Catenin peptide, b-TrCP/Skp1, NRX-2776 ternary complex
9T95 2.15 Å, Crystal structure of beta-TrCP bound by diphosphorylated NRF2 degron peptide.
6M92 2.35 Å, Monophosphorylated pSer33 b-Catenin peptide, b-TrCP/Skp1, NRX-2663 ternary complex
6M91 2.4 Å, Monophosphorylated pSer33 b-Catenin peptide, b-TrCP/Skp1, NRX-103094 ternary complex
6M93 2.5 Å, Monophosphorylated pSer33 b-Catenin peptide, b-TrCP/Skp1, NRX-1933 ternary complex
6M94 2.7 Å, Monophosphorylated pSer33 b-Catenin peptide bound to b-TrCP/Skp1 Complex

Browse structure collections

About this viewer

MolViewer shows 2P64 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.