9TDZ: F-box/WD repeat-containing protein 1A

Crystal structure of beta-TrCP bound by diphosphorylated claspin degron peptide. Determined by X-ray diffraction at 1.35 Å resolution. Released 8 Apr 2026.

Method: X-ray diffraction
Resolution: 1.35 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,271
Mol. weight: 43.72 kDa
Ligands: MG
Released: 8 Apr 2026

Explore 9TDZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9TDZ contains 6 α-helices and 28 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 28 β-strands

Element	Residues	Length	Sheet
α-helix	188-199	12
α-helix	201-210	10
α-helix	212-215	4
α-helix	229-251	23
β-strand	256-261	6	1
β-strand	270-275	6	2
β-strand	279-284	6	2
β-strand	289-293	5	2
β-strand	299-303	5	2
β-strand	310-315	6	3
β-strand	319-324	6	3
β-strand	328-333	6	3
β-strand	339-344	6	3
β-strand	350-356	7	4
β-strand	359-364	6	4
β-strand	369-376	8	4
β-strand	379-386	8	4
β-strand	393-398	6	5
β-strand	402-407	6	5
β-strand	412-416	5	5
β-strand	422-426	5	5
β-strand	433-439	7	6
β-strand	442-447	6	6
β-strand	451-456	6	6
β-strand	461-467	7	6
β-strand	473-478	6	7
β-strand	482-487	6	7
β-strand	491-496	6	7
α-helix	497-500	4
α-helix	507-509	3
β-strand	511-516	6	7
β-strand	522-527	6	1
β-strand	531-536	6	1
β-strand	540-545	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
F-box/WD repeat-containing protein 1A	A	protein	365	Homo sapiens	Q9Y297 (AlphaFold model)
Claspin	B	protein	12	Homo sapiens	Q9HAW4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9TDZ_1 F-box/WD repeat-containing protein 1A (chains A)
GSGMEWKKEIERMVRTDSLWRGLAERRGWGQYLFKNKPPDGNAPPNSFYRALYPKIIQDI
ETIESNWRCGRHSLQRIHCRSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKNTLECKRIL
TGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTGEMLNTLIHHCEAVLHLRFNNGMMVTC
SKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFV
RTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRI
VSGAYDGKIKVWDLVAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILI
WDFLN

Sequence of entity 2 (B), FASTA

>9TDZ_2 Claspin (chains B)
SPSDSGQGSYET

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1

Water and common crystallization additives (EDO) are not listed.

Primary citation

Structural Studies of beta TrCP Reveal Plasticity in Binding Modes of Consensus and Nonconsensus Degrons. Collie, G.W., Mak, H., Acebron-Garcia-de-Eulate, M. et al. ACS Chem Biol (2026) 21:744-750. DOI 10.1021/acschembio.5c01007 · PubMed

Other PDB entries of the same protein (UniProt Q9Y297 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9T9W 1.16 Å, Crystal structure of beta-TrCP bound by diphosphorylated I-kappa-B-alpha degron peptide
9TES 1.22 Å, Crystal structure of beta-TrCP bound by diphosphorylated PDCD4 degron peptide
9TG7 1.68 Å, Crystal structure of beta-TrCP bound by monophosphorylated WEE1 degron peptide
9T8Y 1.79 Å, Crystal structure of beta-TrCP bound by monophosphorylated NRF2 degron peptide.
9TFU 2.0 Å, Crystal structure of beta-TrCP bound by monophosphorylated ATF4 degron peptide
6M90 2.05 Å, Monophosphorylated pSer33 b-Catenin peptide, b-TrCP/Skp1, NRX-2776 ternary complex
9T95 2.15 Å, Crystal structure of beta-TrCP bound by diphosphorylated NRF2 degron peptide.
6M92 2.35 Å, Monophosphorylated pSer33 b-Catenin peptide, b-TrCP/Skp1, NRX-2663 ternary complex
6M91 2.4 Å, Monophosphorylated pSer33 b-Catenin peptide, b-TrCP/Skp1, NRX-103094 ternary complex
2P64 2.5 Å, D domain of b-TrCP
6M93 2.5 Å, Monophosphorylated pSer33 b-Catenin peptide, b-TrCP/Skp1, NRX-1933 ternary complex
6M94 2.7 Å, Monophosphorylated pSer33 b-Catenin peptide bound to b-TrCP/Skp1 Complex

Browse structure collections

About this viewer

MolViewer shows 9TDZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.