2P6V: TAFH domain of the human TAF4 subunit of TFIID

Name: PDB 2P6V: Structure of TAFH domain of the human TAF4 subunit of TFIID
Published: 2007-05-15
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Structure of TAFH domain of the human TAF4 subunit of TFIID. Determined by X-ray diffraction at 2.0 Å resolution. Released 15 May 2007.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 1
Atoms: 820
Mol. weight: 12.75 kDa
Released: 15 May 2007

Explore 2P6V in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2P6V contains 5 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	584-606	23
α-helix	613-627	15
α-helix	633-643	11
α-helix	652-665	14
α-helix	670-676	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription initiation factor TFIID subunit 4	A	protein	114	Homo sapiens	O00268 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2P6V_1 Transcription initiation factor TFIID subunit 4 (chains A)
TVPGATTTSSAATETMENVKKCKNFLSTLIKLASSGKQSTETAANVKELVQNLLDGKIEA
EDFTSRLYRELNSSPQPYLVPFLKRSLPALRQLTPDSAAFIQQSQQQPPPPTSQ

Primary citation

Conserved region I of human coactivator TAF4 binds to a short hydrophobic motif present in transcriptional regulators. Wang, X., Truckses, D.M., Takada, S. et al. Proc Natl Acad Sci U S A (2007) 104:7839-7844. DOI 10.1073/pnas.0608570104 · PubMed

Other PDB entries of the same protein (UniProt O00268 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1H3O 2.3 Å, Crystal Structure of the Human TAF4-TAF12 (TAFII135-TAFII20) Complex
7EGG 2.77 Å, TFIID lobe B subcomplex
7EGF 3.16 Å, TFIID lobe A subcomplex
7EGB 3.3 Å, TFIID-based holo PIC on SCP promoter
7EG9 3.7 Å, TFIID-based intermediate PIC on SCP promoter
7EGC 3.9 Å, p53-bound TFIID-based holo PIC on HDM2 promoter
7ENA 4.07 Å, TFIID-based PIC-Mediator holo-complex in pre-assembled state (pre-hPIC-MED)
7EGA 4.1 Å, TFIID-based intermediate PIC on PUMA promoter
7ENC 4.13 Å, TFIID-based PIC-Mediator holo-complex in fully-assembled state (hPIC-MED)
8GXS 4.16 Å, PIC-Mediator in complex with +1 nucleosome (T40N) in H-binding state
6MZC 4.5 Å, Human TFIID BC core
7EDX 4.5 Å, p53-bound TFIID-based core PIC on HDM2 promoter

Browse structure collections

About this viewer

MolViewer shows 2P6V directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.