2P7V: Escherichia coli regulator of sigma 70, Rsd

Crystal structure of the Escherichia coli regulator of sigma 70, Rsd, in complex with sigma 70 domain 4. Determined by X-ray diffraction at 2.6 Å resolution. Released 21 Aug 2007.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Escherichia coli
Chains: 2
Atoms: 1,865
Mol. weight: 26.27 kDa
Ligands: MG
Released: 21 Aug 2007

Explore 2P7V in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2P7V contains 14 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	2-12	11
α-helix	17-37	21
α-helix	52-67	16
α-helix	68-72	5
α-helix	73-77	5
α-helix	83-105	23
α-helix	106-110	5
α-helix	111-116	6
α-helix	120-154	35

Chain B: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	553-562	10
α-helix	573-580	8
α-helix	584-596	13
α-helix	597-599	3
α-helix	603-607	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Regulator of sigma D	A	protein	158	Escherichia coli	P0AFX4 (AlphaFold model)
RNA polymerase sigma factor rpoD	B	protein	68	Escherichia coli	Q0P6L9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2P7V_1 Regulator of sigma D (chains A)
MLNQLDNLTERVRGSNKLVDRWLHVRKHLLVAYYNLVGIKPGKESYMRLNEKALDDFCQS
LVDYLSAGHFSIYERILHKLEGNGQLARAAKIWPQLEANTQQIMDYYDSSLETAIDHDNY
LEFQQVLSDIGEALEARFVLEDKLILLVLDAARVKHPA

Sequence of entity 2 (B), FASTA

>2P7V_2 RNA polymerase sigma factor rpoD (chains B)
DVLAGLTAREAKVLRMRFGIDMNTDYTLEEVGKQFDVTRERIRQIEAKALRKLRHPSRSE
VLRSFLDD

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1

Primary citation

Crystal structure of the Escherichia coli regulator of sigma70, Rsd, in complex with sigma70 domain 4. Patikoglou, G.A., Westblade, L.F., Campbell, E.A. et al. J Mol Biol (2007) 372:649-659. DOI 10.1016/j.jmb.2007.06.081 · PubMed

Other PDB entries of the same protein (UniProt P0AFX4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4XWJ 2.1 Å, Histidine-containing phosphocarrier protein (HPr) and antisigma factor Rsd complex

Browse structure collections

About this viewer

MolViewer shows 2P7V directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.