2PE8: UHM domain of human SPF45

Crystal structure of the UHM domain of human SPF45 (free form). Determined by X-ray diffraction at 2.0 Å resolution. Released 26 Jun 2007.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 1
Atoms: 791
Mol. weight: 11.69 kDa
Released: 26 Jun 2007

Explore 2PE8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2PE8 contains 5 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	299-301	3
β-strand	306-310	5	1
α-helix	323-329	7
α-helix	330-333	4
β-strand	336-343	8	1
β-strand	353-359	7	1
α-helix	362-372	11
β-strand	376-377	2	2
β-strand	380-381	2	2
β-strand	383-386	4	1
α-helix	389-393	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Splicing factor 45	A	protein	105	Homo sapiens	Q96I25 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2PE8_1 Splicing factor 45 (chains A)
GAMGKCPTKVVLLRNMVGAGEVDEDLEVETKEECEKYGKVGKCVIFEIPGAPDDEAVRIF
LEFERVESAIKAVVDLNGRYFGGRVVKACFYNLDKFRVLDLAEQV

Primary citation

U2AF-homology motif interactions are required for alternative splicing regulation by SPF45. Corsini, L., Bonna, S., Basquin, J. et al. Nat Struct Mol Biol (2007) 14:620-629. DOI 10.1038/nsmb1260 · PubMed

Other PDB entries of the same protein (UniProt Q96I25 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6HIP 1.2 Å, Structure of SPF45 UHM bound to HIV-1 Rev ULM
2PEH 2.11 Å, Crystal structure of the UHM domain of human SPF45 in complex with SF3b155-ULM5
5LSO 2.22 Å, Crystal structure of SPF45 UHM domain with cyclic peptide inhibitor

Browse structure collections

About this viewer

MolViewer shows 2PE8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.