6HIP: SPF45 UHM

Name: PDB 6HIP: Structure of SPF45 UHM bound to HIV-1 Rev ULM
Published: 2019-03-27
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: splicing

Structure of SPF45 UHM bound to HIV-1 Rev ULM. Determined by X-ray diffraction at 1.2 Å resolution. Released 27 Mar 2019.

Method: X-ray diffraction
Resolution: 1.2 Å
Organisms: Homo sapiens, Human immunodeficiency virus 1
Chains: 3
Atoms: 2,186
Mol. weight: 24.9 kDa
Ligands: TRP
Released: 27 Mar 2019

Explore 6HIP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6HIP contains 11 α-helices and 13 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	299-301	3
β-strand	306-310	5	1
α-helix	320-330	11
β-strand	336-343	8	1
β-strand	353-359	7	1
α-helix	362-372	11
β-strand	376-377	2	2
β-strand	380-381	2	2
α-helix	382	1
β-strand	383-387	5	1
α-helix	389-393	5

Chain B: 6 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	299-301	3
β-strand	306-310	5	3
α-helix	322-330	9
α-helix	331-333	3
β-strand	336-343	8	3
β-strand	353-359	7	3
α-helix	362-372	11
β-strand	376-377	2	4
β-strand	380-381	2	4
α-helix	382	1
β-strand	383-387	5	3
α-helix	389-393	5

Chain C: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	45	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Splicing factor 45	A, B	protein	104	Homo sapiens	Q96I25 (AlphaFold model)
HIV-1 Rev (41-49)	C	protein	9	Human immunodeficiency virus 1	P04618

Sequence of entity 1 (A, B), FASTA

>6HIP_1 Splicing factor 45 (chains A, B)
AMGKCPTKVVLLRNMVGAGEVDEDLEVETKEECEKYGKVGKCVIFEIPGAPDDEAVRIFL
EFERVESAIKAVVDLNGRYFGGRVVKACFYNLDKFRVLDLAEQV

Sequence of entity 2 (C), FASTA

>6HIP_2 HIV-1 Rev (41-49) (chains C)
RRRRWRERQ

Ligands and cofactors

ID	Name	Formula	Copies
TRP	Tryptophan	C11 H12 N2 O2	1

Water and common crystallization additives (NA) are not listed.

Primary citation

Modulation of HIV-1 gene expression by binding of a ULM motif in the Rev protein to UHM-containing splicing factors. Pabis, M., Corsini, L., Vincendeau, M. et al. Nucleic Acids Res (2019) 47:4859-4871. DOI 10.1093/nar/gkz185 · PubMed

Other PDB entries of the same protein (UniProt Q96I25 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2PE8 2.0 Å, Crystal structure of the UHM domain of human SPF45 (free form)
2PEH 2.11 Å, Crystal structure of the UHM domain of human SPF45 in complex with SF3b155-ULM5
5LSO 2.22 Å, Crystal structure of SPF45 UHM domain with cyclic peptide inhibitor

Browse structure collections

About this viewer

MolViewer shows 6HIP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.