5LSO: SPF45 UHM domain with cyclic peptide inhibitor

Crystal structure of SPF45 UHM domain with cyclic peptide inhibitor. Determined by X-ray diffraction at 2.22 Å resolution. Released 26 Oct 2016.

Method: X-ray diffraction
Resolution: 2.22 Å
Organism: Homo sapiens
Chains: 4
Atoms: 1,896
Mol. weight: 24.71 kDa
Released: 26 Oct 2016

Explore 5LSO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5LSO contains 8 α-helices and 14 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	299-301	3
β-strand	306-310	5	1
α-helix	322-330	9
β-strand	336-343	8	1
β-strand	353-359	7	1
α-helix	362-372	11
β-strand	376-377	2	2
β-strand	380-381	2	2
β-strand	383-387	5	1
α-helix	389-393	5

Chains C and D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	4	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Splicing factor 45	A, B	protein	103	Homo sapiens	Q96I25 (AlphaFold model)
Lys-ser-arg-trp-asp-glu	C, D	protein	6	Homo sapiens

Sequence of entity 1 (A, B), FASTA

>5LSO_1 Splicing factor 45 (chains A, B)
AMGKCPTKVVLLRNMVGAGEVDEDLEVETKEECEKYGKVGKCVIFEIPGAPDDEAVRIFL
EFERVESAIKAVVDLNGRYFGGRVVKACFYNLDKFRVLDLAEQ

Sequence of entity 2 (C, D), FASTA

>5LSO_2 LYS-SER-ARG-TRP-ASP-GLU (chains C, D)
KSRWDE

Primary citation

Rational Design of Cyclic Peptide Inhibitors of U2AF Homology Motif (UHM) Domains To Modulate Pre-mRNA Splicing. Jagtap, P.K., Garg, D., Kapp, T.G. et al. J Med Chem (2016) 59:10190-10197. DOI 10.1021/acs.jmedchem.6b01118 · PubMed

Other PDB entries of the same protein (UniProt Q96I25 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6HIP 1.2 Å, Structure of SPF45 UHM bound to HIV-1 Rev ULM
2PE8 2.0 Å, Crystal structure of the UHM domain of human SPF45 (free form)
2PEH 2.11 Å, Crystal structure of the UHM domain of human SPF45 in complex with SF3b155-ULM5

Browse structure collections

About this viewer

MolViewer shows 5LSO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.