2PJI: Rhodostomin P48A mutant

Solution structure of rhodostomin P48A mutant. Determined by solution NMR. Released 8 May 2007.

Method: Solution NMR
Organism: Calloselasma rhodostoma
Chains: 1
Atoms: 498
Mol. weight: 7.32 kDa
Released: 8 May 2007

Explore 2PJI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2PJI contains 1 α-helix and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 6 β-strands

Element	Residues	Length	Sheet
β-strand	15	1	1
β-strand	20	1	1
β-strand	33-34	2	2
β-strand	37-38	2	2
α-helix	39-40	2
β-strand	41-46	6	3
β-strand	55-58	4	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Rhodostoxin-disintegrin rhodostomin	A	protein	68	Calloselasma rhodostoma	P30403 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2PJI_1 Rhodostoxin-disintegrin rhodostomin (chains A)
GKECDCSSPENPCCDAATCKLRPGAQCGEGLCCEQCKFSRAGKICRIARGDMPDDRCTGQ
SADCPRYH

Primary citation

Dynamic Properties of the RGD Motif of Disintegrin Modulate its Recognition to Integrin a5b1. Chuang, W.-J., Chen, C.-Y., Shiu, J.-H. et al. To be published.

Other PDB entries of the same protein (UniProt P30403 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4R5R 0.96 Å, Crystal structure of Rhodostomin KKKRT mutant
3UCI 1.35 Å, Crystal structure of Rhodostomin ARLDDL mutant
7X4V 1.38 Å, Crystal structure of Rhodostomin ARGDDP mutant
7X4Z 1.48 Å, Crystal structure of Rhodostomin ARGDWP mutant
4RQG 1.66 Å, Crystal structure of Rhodostomin
7X4S 1.8 Å, Crystal structure of Rhodostomin ARGDMP mutant
26QZ 1.8 Å, Crystal structure of Rhodostomin ARGDP mutant
4R5U 1.81 Å, Crystal structure of Rhodostomin R46E mutant
9IUJ 2.78 Å, Integrin alpha-v beta-3 in complex with rhodostomin
1N4Y Refined structure of kistrin
1Q7I Structural Analysis of Integrin alpha IIb beta 3- Disintegrin with the AKGDWN Motif
1Q7J Structural Analysis of Integrin alpha IIb beta 3- Disintegrin with the AKGDWN Motif

Browse structure collections

About this viewer

MolViewer shows 2PJI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.