2PLE: Phospholipase C gamma-1, C-terminal SH2 domain

Nuclear magnetic resonance structure of an SH2 domain of phospholipase C-GAMMA1 complexed with a high affinity binding peptide. Determined by solution NMR. Released 26 Jan 1995.

Method: Solution NMR
Organism: Bos taurus
Chains: 2
Atoms: 965
Mol. weight: 13.76 kDa
Released: 26 Jan 1995

Explore 2PLE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2PLE contains 2 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	12-13	2	1
α-helix	20-26	7
β-strand	33-34	2	2
β-strand	36-38	3	1
β-strand	45-46	2	1
β-strand	49-50	2	2
β-strand	56	1	2
β-strand	58	1	3
β-strand	59-60	2	1
β-strand	61-62	2	4
β-strand	67-68	2	4
β-strand	73	1	4
α-helix	77-86	10

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	5	1	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Phospholipase C gamma-1, C-terminal SH2 domain	A	protein	105	Bos taurus	P08487 (AlphaFold model)
Phosphopeptide from pdgf	B	protein	12	Bos taurus	P09619 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2PLE_1 PHOSPHOLIPASE C GAMMA-1, C-TERMINAL SH2 DOMAIN (chains A)
GSPGIHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRV
QQEGQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEENSS

Sequence of entity 2 (B), FASTA

>2PLE_2 PHOSPHOPEPTIDE FROM PDGF (chains B)
DNDYIIPLPDPK

Primary citation

Nuclear magnetic resonance structure of an SH2 domain of phospholipase C-gamma 1 complexed with a high affinity binding peptide. Pascal, S.M., Singer, A.U., Gish, G. et al. Cell (1994) 77:461-472. DOI 10.1016/0092-8674(94)90160-0 · PubMed

Other PDB entries of the same protein (UniProt P08487 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5TNW 1.4 Å, Phospholipase C gamma-1 C-terminal SH2 domain
5TQ1 1.49 Å, Phospholipase C gamma-1 C-terminal SH2 domain bound to a phosphopeptide derived from the…
5TO4 1.7 Å, Phospholipase C gamma-1 C-terminal SH2 domain, spacegroup P212121
5TQS 1.88 Å, Phospholipase C gamma-1 C-terminal SH2 domain bound to a phosphopeptide derived from the…
2FCI Structural basis for the requirement of two phosphotyrosines in signaling mediated by…
2PLD Nuclear magnetic resonance structure of an SH2 domain of phospholipase C-GAMMA1…

Browse structure collections

About this viewer

MolViewer shows 2PLE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.