2POM: TAB1 with manganese ion

TAB1 with manganese ion. Determined by X-ray diffraction at 2.27 Å resolution. Released 3 Jul 2007.

Method: X-ray diffraction
Resolution: 2.27 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,752
Mol. weight: 40.84 kDa
Ligands: MN
Released: 3 Jul 2007

Explore 2POM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2POM contains 15 α-helices and 19 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	17-20	4
α-helix	22	1
β-strand	23	1	1
α-helix	24	1
β-strand	27-32	6	2
β-strand	35-37	3	3
β-strand	44-45	2	3
β-strand	51-57	7	1
β-strand	62-71	10	1
α-helix	75-88	14
α-helix	99-134	36
α-helix	141-143	3
α-helix	146-162	17
β-strand	165-174	10	1
β-strand	177-183	7	1
β-strand	187-194	8	2
β-strand	197-202	6	2
β-strand	208	1	4
α-helix	212-220	9
α-helix	225-231	7
β-strand	239	1	4
β-strand	241	1	5
β-strand	243-244	2	1
α-helix	246-250	5
α-helix	256-258	3
β-strand	267	1	5
β-strand	271-277	7	1
β-strand	283-288	6	2
α-helix	290-300	11
α-helix	305-319	15
α-helix	323-343	21
α-helix	349-351	3
β-strand	354-355	2	3
β-strand	358-366	9	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mitogen-activated protein kinase kinase kinase 7-interacting protein 1	A	protein	372	Homo sapiens	Q15750 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2POM_1 Mitogen-activated protein kinase kinase kinase 7-interacting protein 1 (chains A)
GSMAAQRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPEDSWLKFRS
ENNCFLYGVFNGYDGNRVTNFVAQRLSAELLLGQLNAEHAEADVRRVLLQAFDVVERSFL
ESIDDALAEKASLQSQLPEGVPQHQLPPQYQKILERLKTLEREISGGAMAVVAVLLNNKL
YVANVGTNRALLCKSTVDGLQVTQLNVDHTTENEDELFRLSQLGLDAGKIKQVGIICGQE
STRRIGDYKVKYGYTDIDLLSAAKSKPIIAEPEIHGAQPLDGVTGFLVLMSEGLYKALEA
AHGPGQANQEIAAMIDTEFAKQTSLDAVAQAVVDRVKRIHSDTFASGGERARFCPRHEDM
TLLVRNFGYPLG

Ligands and cofactors

ID	Name	Formula	Copies
MN	Manganese (II) ion	Mn	1

Primary citation

XIAP Induces NF-kappaB Activation via the BIR1/TAB1 Interaction and BIR1 Dimerization. Lu, M., Lin, S.C., Huang, Y. et al. Mol Cell (2007) 26:689-702. DOI 10.1016/j.molcel.2007.05.006 · PubMed

Other PDB entries of the same protein (UniProt Q15750 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7NTH 1.97 Å, Structure of TAK1 in complex with compound 54
7NTI 1.98 Å, Structure of TAK1 in complex with compound 22
5JGA 2.0 Å, Crystal structure of human TAK1/TAB1 fusion protein in complex with ligand 11c
5V5N 2.01 Å, Crystal structure of Takinib bound to TAK1
8GW3 2.05 Å, Crystal structure of human TAK1 kinase domain fused with TAB1
5DIY 2.06 Å, Thermobaculum terrenum O-GlcNAc hydrolase mutant - D120N
5E7R 2.11 Å, Crystal structure of TL10-81 bound to TAK1-TAB1
4GS6 2.2 Å, Irreversible Inhibition of TAK1 Kinase by 5Z-7-Oxozeaenol
2J4O 2.25 Å, Structure of TAB1
5JH6 2.37 Å, Crystal structure of TL10-92 bound to TAK1-TAB1
5J7S 2.37 Å, Crystal structure of SM1-71 bound to TAK1-TAB1
5JK3 2.37 Å, Crystal structure of TL11-128 bound to TAK1-TAB1

Browse structure collections

About this viewer

MolViewer shows 2POM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.