Crystal structure of E60Q mutant of FKBP12. Determined by X-ray diffraction at 0.94 Å resolution. Released 2 Sept 2008.
Explore 2PPP in 3D Show helices and sheets RCSB PDB PDBe
2PPP contains 5 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-8 | 7 | 1 |
| α-helix | 20 | 1 | |
| β-strand | 21-30 | 10 | 1 |
| β-strand | 35-38 | 4 | 1 |
| α-helix | 39-42 | 4 | |
| β-strand | 46-49 | 4 | 1 |
| α-helix | 57-64 | 8 | |
| α-helix | 66-67 | 2 | |
| β-strand | 71-76 | 6 | 1 |
| α-helix | 78-80 | 3 | |
| β-strand | 87 | 1 | 2 |
| β-strand | 91 | 1 | 2 |
| β-strand | 97-106 | 10 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| FK506-binding protein 1A | A | protein | 107 | Homo sapiens | P62942 (AlphaFold model) |
>2PPP_1 FK506-binding protein 1A (chains A) GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWQ EGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Structural coupling between FKBP12 and buried water. Szep, S., Park, S., Boder, E.T. et al. Proteins (2009) 74:603-611. DOI 10.1002/prot.22176 · PubMed
Other PDB entries of the same protein (UniProt P62942 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2PPP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.