2PQ3: N-Terminal Calmodulin Zn-Trapped Intermediate
N-Terminal Calmodulin Zn-Trapped Intermediate. Determined by X-ray diffraction at 1.3 Å resolution. Released 16 Oct 2007.
- Method
- X-ray diffraction
- Resolution
- 1.3 Å
- Organism
- Rattus norvegicus
- Chains
- 1
- Atoms
- 780
- Mol. weight
- 8.72 kDa
- Ligands
- ZN, CAC
- Released
- 16 Oct 2007
Explore 2PQ3 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
2PQ3 contains 5 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 5 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 6-18 | 13 | |
| β-strand | 26-28 | 3 | 1 |
| α-helix | 29-31 | 3 | |
| α-helix | 32-38 | 7 | |
| α-helix | 45-55 | 11 | |
| β-strand | 62-64 | 3 | 1 |
| α-helix | 65-75 | 11 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Calmodulin | A | protein | 76 | Rattus norvegicus | P0DP29 (AlphaFold model) |
Sequence of entity 1 (A), FASTA
>2PQ3_1 Calmodulin (chains A)
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGN
GTIDFPEFLTMMARKM
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| ZN | Zinc ion | Zn | 2 |
| CAC | Cacodylate ion | C2 H6 As O2 | 1 |
Primary citation
A 1.3-A structure of zinc-bound N-terminal domain of calmodulin elucidates potential early ion-binding step. Warren, J.T., Guo, Q., Tang, W.J. J Mol Biol (2007) 374:517-527. DOI 10.1016/j.jmb.2007.09.048 · PubMed
Other PDB entries of the same protein (UniProt P0DP29 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 4J9Y 1.51 Å, Calcium-calmodulin complexed with the calmodulin binding domain from a small conductance…
- 1G4Y 1.6 Å, 1.60 a crystal structure of the gating domain from small conductance potassium channel…
- 3B32 1.6 Å, Crystal Structure of Calcium-Saturated Calmodulin N-Terminal Domain Fragment, Residues…
- 4G28 1.63 Å, Calcium-calmodulin complexed with the calmodulin binding domain from a small conductance…
- 4G27 1.65 Å, Calcium-calmodulin complexed with the calmodulin binding domain from a small conductance…
- 4J9Z 1.66 Å, Calcium-calmodulin complexed with the calmodulin binding domain from a small conductance…
- 9M6G 1.7 Å, the crystal structure of the Ca2+/CaM-CASK-CaMK-Mint1-CID complex
- 9KYS 1.76 Å, the Ca2+/CaM-CASK-ARD complex
- 6MBA 1.8 Å, Crystal Structure of Human Nav1.4 CTerminal Domain in Complex with apo Calmodulin
- 9M5Y 1.8 Å, the crystal structure of the Ca2+/CaM-CASK-CaMK complex
- 9U9D 1.8 Å, Bipartite Genetically Encoded Biosensor sG-GECO1
- 2HQW 1.9 Å, Crystal Structure of Ca2+/Calmodulin bound to NMDA Receptor NR1C1 peptide
Browse structure collections
About this viewer
MolViewer shows 2PQ3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.