9U9D: Bipartite Genetically Encoded Biosensor sG-GECO1

Bipartite Genetically Encoded Biosensor sG-GECO1. Determined by X-ray diffraction at 1.8 Å resolution. Released 17 Sept 2025.

Method: X-ray diffraction
Resolution: 1.8 Å
Organisms: synthetic construct, Gallus gallus, Aequorea victoria
Chains: 2
Atoms: 2,033
Mol. weight: 52.85 kDa
Released: 17 Sept 2025

Explore 9U9D in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9U9D contains 8 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 3 β-strands

Element	Residues	Length	Sheet
β-strand	60-67	8	1
β-strand	72-82	11	1
β-strand	83	1	2
α-helix	84	1

Chain B: 7 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	19-30	12	1
α-helix	37-40	4
β-strand	42-51	10	1
β-strand	60-70	11	1
α-helix	92-96	5
β-strand	100-110	11	1
β-strand	113-124	12	1
α-helix	125-127	3
β-strand	129-136	8	1
α-helix	145-148	4
α-helix	157-159	3
β-strand	161	1	1
α-helix	164-169	6
α-helix	171-174	4
β-strand	180-188	9	1
β-strand	193-203	11	1
β-strand	206-216	11	1
β-strand	229	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myosin light chain kinase, smooth muscle, deglutamylated form,Green fluorescent protein,Calmodulin-1	A	protein	234	synthetic construct, Gallus gallus, Aequorea victoria, Rattus norvegicus	P0DP29 (AlphaFold model), P11799 (AlphaFold model)
Green fluorescent protein	B	protein	232	Aequorea victoria	P42212 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9U9D_1 Myosin light chain kinase, smooth muscle, deglutamylated form,Green fluorescent protein,Calmodulin-1 (chains A)
MGGSHHHHHHGMASMTGGQQMGRDLYDDDDKDPSSRMVDSSRRKWYKTGHAVRVLRRLSS
NVYIMADKQRNGIKANFQICHNLVSLRDQLTEEQIAEIKELFSLFDKDGDGTITTRELGT
VMRSLGQNPTEAELQDMINEVDADGDGTIDFPEFLAMMARKMKYRDTEEEIREAYGVFDK
DGNGYISAAELRHVMTNLGEKLTDEEVDEMLREADIDGDGQVNYEEFVQMMTAK

Sequence of entity 2 (B), FASTA

>9U9D_2 Green fluorescent protein (chains B)
MASWSHPQFEKVNSMDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSTQTKLSKDPNEKRDH
MVLLEFVTAAGITRGMDEPYKGGTGGSMVSKGEELFTGVVPILVELDGDVNGHKFSVSGE
GEGDATYGKLTLKFICTTGKLPVPWPTLVTTLXVQCFSRYPDHMKQHDFFKSAMPEGYIQ
ERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFN

Primary citation

Bipartite Genetically Encoded Biosensors to Sense Calcium Ion Dynamics at Membrane-Membrane Contact Sites. Yamaguchi, I., Barazzuol, L., Dematteis, G. et al. Anal Chem (2025) 97:19848-19861. DOI 10.1021/acs.analchem.5c03831 · PubMed

Other PDB entries of the same protein (UniProt P0DP29 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2PQ3 1.3 Å, N-Terminal Calmodulin Zn-Trapped Intermediate
4J9Y 1.51 Å, Calcium-calmodulin complexed with the calmodulin binding domain from a small conductance…
1G4Y 1.6 Å, 1.60 a crystal structure of the gating domain from small conductance potassium channel…
3B32 1.6 Å, Crystal Structure of Calcium-Saturated Calmodulin N-Terminal Domain Fragment, Residues…
4G28 1.63 Å, Calcium-calmodulin complexed with the calmodulin binding domain from a small conductance…
4G27 1.65 Å, Calcium-calmodulin complexed with the calmodulin binding domain from a small conductance…
4J9Z 1.66 Å, Calcium-calmodulin complexed with the calmodulin binding domain from a small conductance…
9M6G 1.7 Å, the crystal structure of the Ca2+/CaM-CASK-CaMK-Mint1-CID complex
9KYS 1.76 Å, the Ca2+/CaM-CASK-ARD complex
6MBA 1.8 Å, Crystal Structure of Human Nav1.4 CTerminal Domain in Complex with apo Calmodulin
9M5Y 1.8 Å, the crystal structure of the Ca2+/CaM-CASK-CaMK complex
2HQW 1.9 Å, Crystal Structure of Ca2+/Calmodulin bound to NMDA Receptor NR1C1 peptide

Browse structure collections

About this viewer

MolViewer shows 9U9D directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.