2PR9: AP-2 complex subunit mu-1

Mu2 adaptin subunit (AP50) of AP2 adaptor (second domain), complexed with GABAA receptor-gamma2 subunit-derived internalization peptide DEEYGYECL. Determined by X-ray diffraction at 2.51 Å resolution. Released 18 Mar 2008.

Method: X-ray diffraction
Resolution: 2.51 Å
Organism: Rattus norvegicus
Chains: 2
Atoms: 2,174
Mol. weight: 35.34 kDa
Released: 18 Mar 2008

Explore 2PR9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2PR9 contains 4 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	172-185	14	1
β-strand	191-205	15	1
β-strand	211-216	6	2
β-strand	218	1	3
β-strand	241	1	3
β-strand	245-248	4	1
β-strand	253	1	2
β-strand	263-265	3	2
α-helix	266-268	3
β-strand	270-279	10	1
β-strand	287-296	10	4
β-strand	300-309	10	4
β-strand	316-325	10	1
β-strand	330-337	8	4
β-strand	341-345	5	1
α-helix	346-348	3
β-strand	350-359	10	1
β-strand	363-372	10	4
α-helix	384-385	2
β-strand	386-392	7	1
β-strand	401-407	7	2
α-helix	415-417	3
β-strand	419-433	15	1

Chain P: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	7-8	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
AP-2 complex subunit mu-1	A	protein	299	Rattus norvegicus	P84092 (AlphaFold model)
GABA(A) receptor subunit gamma-2 peptide	P	protein	10		P18508 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2PR9_1 AP-2 complex subunit mu-1 (chains A)
MGSSHHHHHHSSGLVPRGSHMQIGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHV
SGRVVMKSYLSGMPECKFGMNDKIVIEKQGKGTADETSKSGKQSIAIDDCTFHQCVRLSK
FDSERSISFIPPDGEFELMRYRTTKDIILPFRVIPLVREVGRTKLEVKVVIKSNFKPSLL
AQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAGMKESQISAEIELLPTN
DKKKWARPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC

Sequence of entity 2 (P), FASTA

>2PR9_2 GABA(A) receptor subunit gamma-2 peptide (chains P)
DEEYGYECLD

Primary citation

Regulation of synaptic inhibition by phospho-dependent binding of the AP2 complex to a YECL motif in the GABAA receptor gamma2 subunit. Kittler, J.T., Chen, G., Kukhtina, V. et al. Proc Natl Acad Sci U S A (2008) 105:3616-3621. DOI 10.1073/pnas.0707920105 · PubMed

Other PDB entries of the same protein (UniProt P84092 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7OIQ 1.85 Å, Crystal structure of AP2 Mu2 in complex with FCHO2 WxxPhi motif (C2 crystal form)
7OFP 1.92 Å, Apo Structure of Mu2 Adaptin Subunit (Ap50) Of AP2 Clathrin Adaptor
7OHZ 2.27 Å, Crystal structure of AP2 Mu2 - FCHO2 chimera (His6-tagged)
1I31 2.5 Å, MU2 adaptin subunit (AP50) of AP2 clathrin adaptor, complexed with EGFR internalization…
6QH5 2.56 Å, AP2 clathrin adaptor mu2T156-phosphorylated core in closed conformation
5WRM 2.6 Å, Mu2 subunit of the clathrin adaptor complex AP2 in complex with IRS-1 Y658 peptide
2VGL 2.6 Å, AP2 clathrin adaptor core
3H85 2.6 Å, Molecular basis for the association of PIPKI gamma-p90 with the clathrin adaptor AP-2
7OI5 2.61 Å, Crystal structure of AP2 Mu2 - FCHO2 chimera (GST cleaved)
5WRK 2.62 Å, Mu2 subunit of the clathrin adaptor complex AP2 in complex with IRS-1 Y608 peptide
1BW8 2.65 Å, MU2 adaptin subunit (AP50) of AP2 adaptor (second domain), complexed with EGFR…
1BXX 2.7 Å, MU2 adaptin subunit (AP50) of AP2 adaptor (second domain), complexed with TGN38…

Browse structure collections

About this viewer

MolViewer shows 2PR9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.