2PVF: Fibroblast growth factor receptor 2

Crystal Structure of Tyrosine Phosphorylated Activated FGF Receptor 2 (FGFR2) Kinase Domain in Complex with ATP Analog and Substrate Peptide. Determined by X-ray diffraction at 1.8 Å resolution. Released 25 Sept 2007.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,470
Mol. weight: 40.87 kDa
Ligands: ACP, MG
Released: 25 Sept 2007

Explore 2PVF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2PVF contains 17 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	475	1	1
α-helix	478-480	3
β-strand	481-489	9	1
β-strand	494-500	7	1
β-strand	513-518	6	1
α-helix	525-541	17
β-strand	547	1	2
α-helix	548-549	2
β-strand	550-554	5	1
β-strand	561-565	5	1
β-strand	571	1	2
α-helix	572-577	6
α-helix	581	1
α-helix	600-619	20
β-strand	622-623	2	3
α-helix	629-631	3
β-strand	632-634	3	2
β-strand	640-642	3	2
β-strand	649-650	2	3
β-strand	657-658	2	4
α-helix	667-669	3
α-helix	672-677	6
β-strand	679-680	2	4
α-helix	682-697	16
α-helix	701-702	2
α-helix	709-718	10
α-helix	722-725	4
α-helix	730-739	10
α-helix	744-746	3
α-helix	748-749	2
α-helix	750-764	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fibroblast growth factor receptor 2	A	protein	334	Homo sapiens	P21802 (AlphaFold model)
Fibroblast growth factor receptor 2	B	protein	15		P21802 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2PVF_1 Fibroblast growth factor receptor 2 (chains A)
MGSSHHHHHHSQDPMLAGVSEYELPEDPKWEFPRDKLTLGKPLGEGAFGQVVMAEAVGID
KDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIV
EYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIH
RDLAARNVLVTENNVMKIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQS
DVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVP
SQRPTFKQLVEDLDRILTLTTNEEYLDLSQPLEQ

Sequence of entity 2 (B), FASTA

>2PVF_2 Fibroblast growth factor receptor 2 (chains B)
TTNEEYLDLSQPLEQ

Ligands and cofactors

ID	Name	Formula	Copies
ACP	Phosphomethylphosphonic acid adenylate ester	C11 H18 N5 O12 P3	1
MG	Magnesium ion	Mg	2

Primary citation

A molecular brake in the kinase hinge region regulates the activity of receptor tyrosine kinases. Chen, H., Ma, J., Li, W. et al. Mol Cell (2007) 27:717-730. DOI 10.1016/j.molcel.2007.06.028 · PubMed

Other PDB entries of the same protein (UniProt P21802 (AlphaFold model), which also has an AlphaFold model), best resolution first:

10OU 1.77 Å, FGFR2 mutant D650V with compound 12
3B2T 1.8 Å, Structure of phosphotransferase
4J99 1.85 Å, Crystal Structure of FGF Receptor 2 (FGFR2) Kinase Domain Harboring the Gain-of-Function…
10OO 1.85 Å, FGFR2 mutant D650V with compound 4 (AZD3463)
5UGL 1.86 Å, Crystal Structure of FGF Receptor 2 Tyrosine Kinase Domain Harboring the D650V…
3CAF 1.96 Å, Crystal Structure of hFGFR2 D2 Domain
10OQ 1.98 Å, FGFR2 mutant D650V with compound 6
9U7S 1.99 Å, FGFR2 kinase domain with a macrocyclic compound 8r
3CLY 2.0 Å, Crystal Structure of FGF Receptor 2 (FGFR2) Kinase Domains Trapped in…
8W3D 2.04 Å, TAS-120 covalent structure with FGFR2 molecular brake mutant
5UI0 2.05 Å, Crystal Structure of the Tyrosine Kinase Domain of FGF Receptor 2 harboring an…
3OJM 2.1 Å, Crystal Structure of FGF1 complexed with the ectodomain of FGFR2b harboring P253R Apert…

Browse structure collections

About this viewer

MolViewer shows 2PVF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.