4J99: Fibroblast growth factor receptor 2

Crystal Structure of FGF Receptor 2 (FGFR2) Kinase Domain Harboring the Gain-of-Function K659T Mutation. Determined by X-ray diffraction at 1.85 Å resolution. Released 7 Aug 2013.

Method

X-ray diffraction

Resolution

1.85 Å

Organism

Homo sapiens

Chains

4

Atoms

9,746

Mol. weight

151.1 kDa

Ligands

MG, ACP

Released

7 Aug 2013

Explore 4J99 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4J99 contains 68 α-helices and 66 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 17 β-strands

Molecules and chains

>4J99_1 Fibroblast growth factor receptor 2 (chains A, B, C, D)
MGSSHHHHHHSQDPMLAGVSEYELPEDPKWEFPRDKLTLGKPLGEGAFGQVVMAEAVGID
KDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIV
EYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIH
RDLAARNVLVTENNVMKIADFGLARDINNIDYYKTTTNGRLPVKWMAPEALFDRVYTHQS
DVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVP
SQRPTFKQLVEDLDRILTLTTNEE

Ligands and cofactors

Water and common crystallization additives (SO4) are not listed.

Primary citation

Cracking the Molecular Origin of Intrinsic Tyrosine Kinase Activity through Analysis of Pathogenic Gain-of-Function Mutations. Chen, H., Huang, Z., Dutta, K. et al. Cell Rep (2013) 4:376-384. DOI 10.1016/j.celrep.2013.06.025 · PubMed

Related structures

Other PDB entries of the same protein (UniProt P21802 (AlphaFold model), which also has an AlphaFold model), best resolution first:

• 10OU 1.77 Å, FGFR2 mutant D650V with compound 12
• 2PVF 1.8 Å, Crystal Structure of Tyrosine Phosphorylated Activated FGF Receptor 2 (FGFR2) Kinase…
• 3B2T 1.8 Å, Structure of phosphotransferase
• 10OO 1.85 Å, FGFR2 mutant D650V with compound 4 (AZD3463)
• 5UGL 1.86 Å, Crystal Structure of FGF Receptor 2 Tyrosine Kinase Domain Harboring the D650V…
• 3CAF 1.96 Å, Crystal Structure of hFGFR2 D2 Domain
• 10OQ 1.98 Å, FGFR2 mutant D650V with compound 6
• 9U7S 1.99 Å, FGFR2 kinase domain with a macrocyclic compound 8r
• 3CLY 2.0 Å, Crystal Structure of FGF Receptor 2 (FGFR2) Kinase Domains Trapped in…
• 8W3D 2.04 Å, TAS-120 covalent structure with FGFR2 molecular brake mutant
• 5UI0 2.05 Å, Crystal Structure of the Tyrosine Kinase Domain of FGF Receptor 2 harboring an…
• 3OJM 2.1 Å, Crystal Structure of FGF1 complexed with the ectodomain of FGFR2b harboring P253R Apert…

Browse structure collections

About this viewer

MolViewer shows 4J99 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.