3CLY: Fibroblast growth factor receptor 2

Crystal Structure of FGF Receptor 2 (FGFR2) Kinase Domains Trapped in Trans-Phosphorylation Reaction. Determined by X-ray diffraction at 2.0 Å resolution. Released 3 Feb 2009.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,410
Mol. weight: 39.01 kDa
Ligands: MG, ACP
Released: 3 Feb 2009

Explore 3CLY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3CLY contains 16 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	1475	1	1
α-helix	1478-1480	3
β-strand	1481-1486	6	1
β-strand	1495-1501	7	1
β-strand	1511-1517	7	1
α-helix	1525-1541	17
β-strand	1547	1	2
α-helix	1548-1549	2
β-strand	1550-1554	5	1
β-strand	1561-1565	5	1
β-strand	1571	1	2
α-helix	1572-1577	6
α-helix	1600-1619	20
β-strand	1622-1623	2	3
α-helix	1629-1631	3
β-strand	1632-1634	3	2
β-strand	1640-1642	3	2
β-strand	1649-1650	2	3
β-strand	1657-1658	2	4
α-helix	1667-1669	3
α-helix	1672-1676	5
β-strand	1679-1680	2	4
α-helix	1682-1697	16
α-helix	1701-1702	2
α-helix	1709-1717	9
α-helix	1722-1725	4
α-helix	1730-1739	10
α-helix	1744-1746	3
α-helix	1748-1749	2
α-helix	1750-1767	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fibroblast growth factor receptor 2	A	protein	334	Homo sapiens	P21802 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3CLY_1 Fibroblast growth factor receptor 2 (chains A)
MGSSHHHHHHSQDPMLAGVSEYELPEDPKWEFPRDKLTLGKPLGEGAFGQVVMAEAVGID
KDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIV
EYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIH
RDLAARNVLVTENNVMKIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQS
DVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVP
SQRPTFKQLVEDLDRILTLTTNEEYLDLSQPLEQ

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	2
ACP	Phosphomethylphosphonic acid adenylate ester	C11 H18 N5 O12 P3	1

Primary citation

A crystallographic snapshot of tyrosine trans-phosphorylation in action. Chen, H., Xu, C.F., Ma, J. et al. Proc Natl Acad Sci U S A (2008) 105:19660-19665. DOI 10.1073/pnas.0807752105 · PubMed

Other PDB entries of the same protein (UniProt P21802 (AlphaFold model), which also has an AlphaFold model), best resolution first:

10OU 1.77 Å, FGFR2 mutant D650V with compound 12
2PVF 1.8 Å, Crystal Structure of Tyrosine Phosphorylated Activated FGF Receptor 2 (FGFR2) Kinase…
3B2T 1.8 Å, Structure of phosphotransferase
4J99 1.85 Å, Crystal Structure of FGF Receptor 2 (FGFR2) Kinase Domain Harboring the Gain-of-Function…
10OO 1.85 Å, FGFR2 mutant D650V with compound 4 (AZD3463)
5UGL 1.86 Å, Crystal Structure of FGF Receptor 2 Tyrosine Kinase Domain Harboring the D650V…
3CAF 1.96 Å, Crystal Structure of hFGFR2 D2 Domain
10OQ 1.98 Å, FGFR2 mutant D650V with compound 6
9U7S 1.99 Å, FGFR2 kinase domain with a macrocyclic compound 8r
8W3D 2.04 Å, TAS-120 covalent structure with FGFR2 molecular brake mutant
5UI0 2.05 Å, Crystal Structure of the Tyrosine Kinase Domain of FGF Receptor 2 harboring an…
3OJM 2.1 Å, Crystal Structure of FGF1 complexed with the ectodomain of FGFR2b harboring P253R Apert…

Browse structure collections

About this viewer

MolViewer shows 3CLY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.