2Q3Y: Ancestral Corticiod Receptor

Ancestral Corticiod Receptor in Complex with DOC. Determined by X-ray diffraction at 2.4 Å resolution. Released 4 Sept 2007.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: unidentified
Chains: 2
Atoms: 2,196
Mol. weight: 30.41 kDa
Ligands: 1CA
Released: 4 Sept 2007

Explore 2Q3Y in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2Q3Y contains 12 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	1-8	8
α-helix	10-12	3
α-helix	25-48	24
α-helix	58-85	28
β-strand	90-93	4	1
β-strand	96-98	3	1
α-helix	100-105	6
α-helix	109-125	17
α-helix	129-140	12
β-strand	143-145	3	2
α-helix	152-169	18
α-helix	177-210	34
α-helix	212-215	4
α-helix	221-235	15
β-strand	239-241	3	2

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	19-25	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ancestral Corticiod Receptor	A	protein	249	unidentified
Nuclear receptor 0B2	B	protein	10		Q15466 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2Q3Y_1 Ancestral Corticiod Receptor (chains A)
GEFLISILEAIEPEVVYAGYDNSQPDTTNYLLSSLNRLAGKQMVSVVKWAKALPGFRNLH
LDDQMTLIQYSWMSLMAFSLGWRSYKHTNGQMLYFAPDLIFNEERMQQSAMYDLCQGMRQ
ISQEFVRLQVTYEEFLCMKVLLLLSTVPKDGLKSQASFDEMRMNYIKELRRAIARNENNS
SQNWQRFYQLTKLLDSMHDLVGGLLQFCFYTFVQSQALSVEFPEMLVEIISDQLPKVMAG
MAKPLLFHK

Sequence of entity 2 (B), FASTA

>2Q3Y_2 Nuclear receptor 0B2 (chains B)
PAILYALLSS

Ligands and cofactors

ID	Name	Formula	Copies
1CA	Desoxycorticosterone	C21 H30 O3	1

Water and common crystallization additives (GOL) are not listed.

Primary citation

Crystal structure of an ancient protein: evolution by conformational epistasis. Ortlund, E.A., Bridgham, J.T., Redinbo, M.R. et al. Science (2007) 317:1544-1548. DOI 10.1126/science.1142819 · PubMed

Other PDB entries of the same protein (UniProt Q15466 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6W9M 1.59 Å, Structure of the Ancestral Glucocorticoid Receptor 2 ligand binding domain in complex…
4ONI 1.8 Å, Structure of Human Orphan Receptor LRH1 bound to two bacterial phospholipids
1YUC 1.9 Å, Human Nuclear Receptor Liver Receptor Homologue-1, LRH-1, Bound to Phospholipid and a…
4DOR 1.9 Å, Human Nuclear Receptor Liver Receptor Homologue-1, LRH-1, in its apo State Bound to a…
5UFS 2.12 Å, X-Ray Crystal Structure of the Ancestral Glucocorticoid Receptor 2 ligand binding domain…
7YXC 2.25 Å, Crystal structure of WT AncGR2-LBD bound to dexamethasone and SHP coregulator fragment
7YXD 2.3 Å, Crystal structure of WT AncGR2-LBD bound to dexamethasone and SHP coregulator fragment
7YXN 2.46 Å, Crystal structure of WT AncGR2-LBD bound to dexamethasone and SHP coregulator fragment
7YXR 2.5 Å, Crystal structure of mutant AncGR2-LBD (Y545A) bound to dexamethasone and SHP…
2Z4J 2.6 Å, Crystal structure of AR LBD with SHP peptide NR Box 2
9HDF 2.78 Å, Glucocorticoid Receptor Ligand Binding Domain in complex with dexamethasone
7YXO 2.99 Å, Crystal structure of WT AncGR2-LBD bound to dexamethasone and SHP coregulator fragment

Browse structure collections

About this viewer

MolViewer shows 2Q3Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.