2Z4J: AR LBD with SHP peptide NR Box 2

Crystal structure of AR LBD with SHP peptide NR Box 2. Determined by X-ray diffraction at 2.6 Å resolution. Released 4 Dec 2007.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,137
Mol. weight: 30.36 kDa
Ligands: DHT
Released: 4 Dec 2007

Explore 2Z4J in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2Z4J contains 15 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	672-679	8
α-helix	694-695	2
α-helix	697-720	24
α-helix	725-727	3
α-helix	730-755	26
β-strand	762-765	4	1
β-strand	768-770	3	1
α-helix	771	1
α-helix	772-777	6
α-helix	781-796	16
α-helix	801-812	12
β-strand	815-817	3	2
α-helix	824-843	20
α-helix	850-882	33
α-helix	884-887	4
α-helix	893-901	9
α-helix	903-907	5
β-strand	911-913	3	2

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	118-122	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Androgen receptor	A	protein	248	Homo sapiens	P10275 (AlphaFold model)
Nuclear receptor 0B2	B	protein	10		Q15466 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2Z4J_1 Androgen receptor (chains A)
PIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHV
DDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHL
SQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPT
SCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGK
VKPIYFHT

Sequence of entity 2 (B), FASTA

>2Z4J_2 Nuclear receptor 0B2 (chains B)
PSILKKILLE

Ligands and cofactors

ID	Name	Formula	Copies
DHT	5-alpha-dihydrotestosterone	C19 H30 O2	1

Primary citation

Interaction between the androgen receptor and a segment of its corepressor SHP. Jouravel, N., Sablin, E., Arnold, L.A. et al. Acta Crystallogr D Biol Crystallogr (2007) 63:1198-1200. DOI 10.1107/S0907444907045702 · PubMed

Other PDB entries of the same protein (UniProt P10275 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8E1A 1.2 Å, Structure-based study to overcome cross-reactivity of novel androgen receptor inhibitors
7ZTZ 1.4 Å, Crystal structure of mutant AR-LBD (Y764C) bound to dihydrotestosterone
4OHA 1.42 Å, Crystal structure of T877A-AR-LBD bound with co-regulator peptide
5V8Q 1.44 Å, Synthesis and biological evaluation of novel selective androgen receptor modulators…
2AX6 1.5 Å, Crystal Structure Of The Androgen Receptor Ligand Binding Domain T877A Mutant In Complex…
3L3X 1.55 Å, Crystal structure of DHT-bound androgen receptor in complex with the first motif of…
8FH0 1.59 Å, Crystal structure of mutant Androgen Receptor ligand binding domain H875Y/F877L/T878A…
8FH2 1.59 Å, Crystal structure of mutant Androgen Receptor ligand binding domain L702H/H875Y with DHT
8FGZ 1.61 Å, Crystal structure of mutant Androgen Receptor ligand binding domain L702H/H875Y/F877L…
2AM9 1.64 Å, Crystal structure of human androgen receptor ligand binding domain in complex with…
2AX9 1.65 Å, Crystal Structure Of The Androgen Receptor Ligand Binding Domain In Complex With R-3
2PNU 1.65 Å, Crystal structure of human androgen receptor ligand-binding domain in complex with EM-5744

Browse structure collections

About this viewer

MolViewer shows 2Z4J directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.