2Q9A: Apo FTSY

Structure of Apo FTSY. Determined by X-ray diffraction at 2.24 Å resolution. Released 3 Jul 2007.

Method: X-ray diffraction
Resolution: 2.24 Å
Organism: Thermus aquaticus
Chains: 2
Atoms: 5,008
Mol. weight: 67.63 kDa
Released: 3 Jul 2007

Explore 2Q9A in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2Q9A contains 34 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	3-10	8
α-helix	12-15	4
α-helix	19-21	3
α-helix	28-41	14
α-helix	46-56	11
α-helix	64-75	12
α-helix	80-87	8
β-strand	104-108	5	1
α-helix	115-128	14
β-strand	133-136	4	1
α-helix	149-156	8
β-strand	160-161	2	1
α-helix	169-182	14
β-strand	187-190	4	1
α-helix	202-216	15
β-strand	223-229	7	1
α-helix	230-232	3
α-helix	235-247	13
β-strand	251-255	5	1
α-helix	257-259	3
α-helix	263-265	3
α-helix	266-273	8
β-strand	277-281	5	1
α-helix	286-288	3
β-strand	289-291	3	1
α-helix	292	1
α-helix	294-302	9

Chain B: 15 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	3-10	8
α-helix	12-16	5
α-helix	19-21	3
α-helix	30-41	12
α-helix	46-57	12
α-helix	64-75	12
β-strand	104-108	5	2
α-helix	115-128	14
β-strand	133-136	4	2
α-helix	144-156	13
β-strand	160-161	2	2
α-helix	169-182	14
β-strand	187-190	4	2
α-helix	202-216	15
β-strand	223-229	7	2
α-helix	234-247	14
β-strand	251-255	5	2
α-helix	263-265	3
α-helix	266-273	8
β-strand	277-281	5	2
β-strand	289-291	3	2
α-helix	292	1
α-helix	294-301	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cell division protein ftsY	A, B	protein	304	Thermus aquaticus	P83749 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2Q9A_1 Cell division protein ftsY (chains A, B)
MGFFDRLKAGLAKTRERLLKAIPWGGNLEEVLEELEMALLAADVGLSATEEILQEVRASG
RKDLKEAVKEKLVGMLEPDERRATLRKLGFNPQKPKPVEPKGRVVLVVGVNGVGKTTTIA
KLGRYYQNLGKKVMFCAGDTFRAAGGTQLSEWGKRLSIPVIQGPEGTDPAALAYDAVQAM
KARGYDLLFVDTAGRLHTKHNLMEELKKVKRAIAKADPEEPKEVWLVLDAVTGQNGLEQA
KKFHEAVGLTGVIVTKLDGTAKGGVLIPIVRTLKVPIKFVGVGEGPDDLQPFDPEAFVEA
LLED

Primary citation

X-ray Structures of the Signal Recognition Particle Receptor Reveal Targeting Cycle Intermediates. Reyes, C.L., Rutenber, E., Walter, P. et al. PLoS One (2007) 2:e607-e607. DOI 10.1371/journal.pone.0000607 · PubMed

Other PDB entries of the same protein (UniProt P83749 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1RJ9 1.9 Å, Structure of the heterodimer of the conserved GTPase domains of the Signal Recognition…
2J7P 1.97 Å, GMPPNP-stabilized NG domain complex of the SRP GTPases Ffh and FtsY
1OKK 2.05 Å, Homo-heterodimeric complex of the srp gtpases
2IYL 2.1 Å, Structure of an FtsY:GDP complex
2Q9C 2.2 Å, Structure of FTSY:GMPPNP with MGCL Complex
2Q9B 2.3 Å, Structure of FTSY:GMPPNP Complex
2CNW 2.39 Å, GDPALF4 complex of the SRP GTPases Ffh and FtsY
2XKV 13.5 Å, Atomic Model of the SRP-FtsY Early Conformation

Browse structure collections

About this viewer

MolViewer shows 2Q9A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.