2QEJ: Staphylococcus aureus protein

Crystal structure of a Staphylococcus aureus protein (SSL7) in complex with Fc of human IgA1. Determined by X-ray diffraction at 3.2 Å resolution. Released 18 Sept 2007.

Method: X-ray diffraction
Resolution: 3.2 Å
Organisms: Homo sapiens, Staphylococcus aureus
Chains: 4
Atoms: 6,418
Mol. weight: 94.39 kDa
Ligands: CA
Released: 18 Sept 2007

Explore 2QEJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2QEJ contains 27 α-helices and 72 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	247-249	3	1
α-helix	253-258	6
β-strand	264-267	4	1
β-strand	279-281	3	2
β-strand	291	1	1
β-strand	296	1	3
β-strand	302	1	3
β-strand	305-308	4	1
α-helix	312-316	5
β-strand	320-325	6	2
β-strand	334-339	6	2
β-strand	348-352	5	4
α-helix	353-355	3
β-strand	364-374	11	4
β-strand	380-385	6	5
β-strand	388-389	2	5
α-helix	390-391	2
α-helix	392-394	3
β-strand	396-397	2	4
β-strand	401-402	2	4
α-helix	403-404	2
β-strand	411-420	10	4
α-helix	421-425	5
β-strand	430-435	6	5
β-strand	441	1	5
β-strand	443-448	6	5

Chain B: 8 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	245-249	5	6
α-helix	250-252	3
α-helix	253-258	6
β-strand	264-269	6	6
β-strand	278-280	3	7
β-strand	304-308	5	6
α-helix	314-317	4
β-strand	323-326	4	7
β-strand	334-336	3	7
β-strand	350-352	3	8
α-helix	353-355	3
α-helix	356-361	6
β-strand	364-374	11	8
β-strand	380-385	6	9
β-strand	388-390	3	9
α-helix	391	1
α-helix	392-394	3
β-strand	396-397	2	8
β-strand	401-402	2	8
β-strand	411-420	10	8
α-helix	421-426	6
β-strand	430-435	6	9
β-strand	443-448	6	9

Chain C: 6 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	14-21	8
β-strand	24-27	4	10
β-strand	31-32	2	11
β-strand	35	1	12
α-helix	37-39	3
β-strand	42-46	5	12
β-strand	51-55	5	12
α-helix	59-63	5
β-strand	68-69	2	11
β-strand	72-76	5	10
β-strand	79-80	2	12
β-strand	85-89	5	12
β-strand	92-93	2	10
β-strand	103-107	5	13
β-strand	109	1	14
β-strand	118	1	14
β-strand	121-124	4	13
β-strand	129-131	3	15
α-helix	132-147	16
β-strand	151	1	16
β-strand	154	1	16
β-strand	159-163	5	13
β-strand	168-171	4	13
α-helix	179-181	3
β-strand	185-187	3	15
α-helix	188-190	3
β-strand	191-195	5	13

Chain D: 6 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	13-19	7
β-strand	24-28	5	17
β-strand	32	1	18
β-strand	35-37	3	19
β-strand	40-47	8	19
β-strand	50-56	7	19
α-helix	59-63	5
β-strand	68	1	18
β-strand	72-76	5	17
β-strand	79-80	2	19
β-strand	85-89	5	19
β-strand	92-93	2	17
β-strand	102-110	9	20
β-strand	119-125	7	20
β-strand	129-131	3	21
α-helix	132-145	14
β-strand	157-162	6	20
β-strand	168-172	5	20
α-helix	176-178	3
α-helix	179-183	5
β-strand	185-187	3	21
α-helix	188-190	3
β-strand	193-198	6	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ig alpha-1 C region	A, B	protein	216	Homo sapiens	P01876 (AlphaFold model)
Superantigen-like molecule 7	C, D	protein	201	Staphylococcus aureus	A0A9Y2YA69 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2QEJ_1 IG ALPHA-1 C REGION (chains A, B)
ESCHPRLSLHRPALEDLLLGSEANLTCTLTGLRDASGVTFTWTPSSGKSAVQGPPERDLC
GCYSVSSVLPGCAEPWNHGKTFTCTAAYPESKTPLTATLSKSGNTFRPEVHLLPPPSEEL
ALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVTSILRV
AAEDWKKGDTFSCMVGHEALPLAFTQKTIDRLAGKP

Sequence of entity 2 (C, D), FASTA

>2QEJ_2 SUPERANTIGEN-LIKE MOLECULE 7 (chains C, D)
KEKQERVQHLYDIKDLHRYYSSESFEFSNISGKVENYNGSNVVRFNQEKQNHQLFLLGED
KAKYKQGLQGQDVFVVKELIDPNGRLSTVGGVTKKNNQSSETNIHLLVNKLDGGNLDATN
DSFLINKEEVSLKELDFKIRKQLVEKYGLYQGTSKYGKITIILNGGKKQEIDLGDKLQFE
RMGDVLNSKDINKIEVTLKQI

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	1

Water and common crystallization additives (GOL) are not listed.

Primary citation

Structural basis for evasion of IgA immunity by Staphylococcus aureus revealed in the complex of SSL7 with Fc of human IgA1. Ramsland, P.A., Willoughby, N., Trist, H.M. et al. Proc Natl Acad Sci U S A (2007) 104:15051-15056. DOI 10.1073/pnas.0706028104 · PubMed

Other PDB entries of the same protein (UniProt P01876 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9R2E 2.54 Å, Structure of ARGX-121 Fab fragment in complex with the Fc fragment of IgA1
9OFR 2.65 Å, Crystal structure of the human IGA1 fc fragment-fc-alpha receptor (CD89) complex
6UE7 2.9 Å, Structure of dimeric sIgA complex
1OW0 3.1 Å, Crystal structure of human FcaRI bound to IgA1-Fc
8SKV 3.1 Å, Structure of human SIgA1 in complex with Streptococcus pyogenes protein M4 (Arp4)
6LX3 3.15 Å, Cryo-EM structure of human secretory immunoglobulin A
8SKU 3.2 Å, Structure of human SIgA1 in complex with human CD89 (FcaR1)
6LXW 3.27 Å, Cryo-EM structure of human secretory immunoglobulin A in complex with the N-terminal…
9MBZ 3.3 Å, Cryo-EM structure of human FcRL4 bound to IgA-Fc/J
7UVL 3.56 Å, IgA1 Protease with IgA1 substrate
6XJA 4.0 Å, Streptococcus Pneumoniae IgA1 Protease with IgA1 substrate
1IGA Model of human IGA1 determined by solution scattering curve-fitting and homology modelling

Browse structure collections

About this viewer

MolViewer shows 2QEJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.