2QFJ: First Two RRM Domains of FIR

Crystal Structure of First Two RRM Domains of FIR Bound to ssDNA from a Portion of FUSE. Determined by X-ray diffraction at 2.1 Å resolution. Released 4 Mar 2008.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 3
Atoms: 3,010
Mol. weight: 54.51 kDa
Released: 4 Mar 2008

Explore 2QFJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2QFJ contains 16 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 8 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	101-111	11
β-strand	113-117	5	1
α-helix	125-132	8
α-helix	133-135	3
β-strand	138-143	6	1
β-strand	155-160	6	1
α-helix	163-173	11
β-strand	184-186	3	1
α-helix	192-194	3
α-helix	195-205	11
β-strand	210-214	5	2
α-helix	222-229	8
β-strand	235-242	8	2
β-strand	249-257	9	2
α-helix	260-270	11
β-strand	274	1	3
β-strand	279	1	3
β-strand	281-284	4	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA (5'-d(dtpdcpdgpdgpdgpdapdtpdtpdtpdtpdtpdtpdapdtpdtpdtpdtpdgpdtpdgpdtpdtp*…	C	DNA	25
FBP-interacting repressor	A, B	protein	216	Homo sapiens	Q9UHX1 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>2QFJ_1 DNA (5'-D(*DTP*DCP*DGP*DGP*DGP*DAP*DTP*DTP*DTP*DTP*DTP*DTP*DAP*DTP*DTP*DTP*DTP*DGP*DTP*DGP*DTP*DTP*DAP*DTP*DT)-3') (chains C)
TCGGGATTTTTTATTTTGTGTTATT

Sequence of entity 2 (A, B), FASTA

>2QFJ_2 FBP-interacting repressor (chains A, B)
GSHMASMTGGQQMGRGSAAQRQGALAIMSRVYVGSIYYELGEDTIRQAFAPFGPIKSIDM
SWDSVTMKHKGFAFVEYEVPEAAQLALEQMNSVMLGGRNIKVGRPSNIGQAQPIIDQLAE
EARAFNRIYVASVHQDLSDDDIKSVFEAFGKIKSATLARDPTTGKHKGYGFIEYEKAQSS
QDAVSSMNLFDLGGQYLRVGKAVTPPMPLLTPATPG

Primary citation

Dimerization of FIR upon FUSE DNA binding suggests a mechanism of c-myc inhibition. Crichlow, G.V., Zhou, H., Hsiao, H.-H. et al. EMBO J (2007) 27:277-289. DOI 10.1038/sj.emboj.7601936 · PubMed

Other PDB entries of the same protein (UniProt Q9UHX1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3UE2 1.23 Å, Crystal structure of a RNA binding domain of poly-U binding splicing factor 60KDa…
3US5 1.38 Å, Crystal structure of a RNA-binding domain of a poly-U binding splicing factor 60KDa…
7Z3X 1.65 Å, Crystal structure of FIR RRM1-2 Y115F mutant bound to FUSE ssDNA
5KW6 1.91 Å, Two Tandem RRM Domains of PUF60 Bound to an AdML Pre-mRNA 3' Splice Site Analogue with a…
5KVY 1.95 Å, Crystal structure of the two tandem rrm domains of PUF60 bound to a portion of an adml…
6LUR 2.0 Å, Human PUF60 UHM domain (thioredoxin fusion) in complex with a small molecule binder
7Q8A 2.05 Å, Crystal structure of tandem domain RRM1-2 of FUBP-interacting repressor (FIR) bound to…
5KW1 2.1 Å, Crystal Structure of the Two Tandem RRM Domains of PUF60 Bound to a Modified AdML…
3DXB 2.2 Å, Structure of the UHM domain of Puf60 fused to thioredoxin
3UWT 2.5 Å, Crystal structure of a RNA binding domain of poly-U binding splicing factor 60KDa…
5KWQ 2.8 Å, Two Tandem RRM Domains of FBP-Interacting Repressor (FIR), also Known as PUF60
2DNY Solution structure of the third RNA binding domain of FBP-interacting repressor, SIAHBP1

Browse structure collections

About this viewer

MolViewer shows 2QFJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.