3UE2: Poly-binding-splicing factor PUF60

Crystal structure of a RNA binding domain of poly-U binding splicing factor 60KDa (PUF60) from Homo sapiens at 1.23 A resolution. Determined by X-ray diffraction at 1.23 Å resolution. Released 30 Nov 2011.

Method: X-ray diffraction
Resolution: 1.23 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,237
Mol. weight: 13.72 kDa
Released: 30 Nov 2011

Explore 3UE2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3UE2 contains 6 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	445-448	4
α-helix	453-459	7
β-strand	463-467	5	1
α-helix	472-474	3
α-helix	479-487	9
β-strand	493-503	11	1
β-strand	510-519	10	1
α-helix	522-532	11
β-strand	536-537	2	2
β-strand	540-541	2	2
β-strand	543-547	5	1
α-helix	549-553	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Poly(U)-binding-splicing factor PUF60	A	protein	118	Homo sapiens	Q9UHX1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3UE2_1 Poly(U)-binding-splicing factor PUF60 (chains A)
GSGSSARHMVMQKLLRKQESTVMVLRNMVDPKDIDDDLEGEVTEECGKFGAVNRVIIYQE
KQGEEEDAEIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYDQERFDNSDLSA

Primary citation

Crystal structure of a RNA binding domain of poly-U binding splicing factor 60KDa (PUF60) from Homo sapiens at 1.23 A resolution. Joint Center for Structural Genomics (JCSG), Partnership for T-Cell Biology. To be published.

Other PDB entries of the same protein (UniProt Q9UHX1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3US5 1.38 Å, Crystal structure of a RNA-binding domain of a poly-U binding splicing factor 60KDa…
7Z3X 1.65 Å, Crystal structure of FIR RRM1-2 Y115F mutant bound to FUSE ssDNA
5KW6 1.91 Å, Two Tandem RRM Domains of PUF60 Bound to an AdML Pre-mRNA 3' Splice Site Analogue with a…
5KVY 1.95 Å, Crystal structure of the two tandem rrm domains of PUF60 bound to a portion of an adml…
6LUR 2.0 Å, Human PUF60 UHM domain (thioredoxin fusion) in complex with a small molecule binder
7Q8A 2.05 Å, Crystal structure of tandem domain RRM1-2 of FUBP-interacting repressor (FIR) bound to…
2QFJ 2.1 Å, Crystal Structure of First Two RRM Domains of FIR Bound to ssDNA from a Portion of FUSE
5KW1 2.1 Å, Crystal Structure of the Two Tandem RRM Domains of PUF60 Bound to a Modified AdML…
3DXB 2.2 Å, Structure of the UHM domain of Puf60 fused to thioredoxin
3UWT 2.5 Å, Crystal structure of a RNA binding domain of poly-U binding splicing factor 60KDa…
5KWQ 2.8 Å, Two Tandem RRM Domains of FBP-Interacting Repressor (FIR), also Known as PUF60
2DNY Solution structure of the third RNA binding domain of FBP-interacting repressor, SIAHBP1

Browse structure collections

About this viewer

MolViewer shows 3UE2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.