2QJZ: PDB entry 2QJZ

Structural Basis of Microtubule Plus End Tracking by XMAP215, CLIP-170 and EB1. Determined by X-ray diffraction at 1.25 Å resolution. Released 2 Oct 2007.

Method: X-ray diffraction
Resolution: 1.25 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,276
Mol. weight: 28.91 kDa
Released: 2 Oct 2007

Explore 2QJZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2QJZ contains 17 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	14-16	3
α-helix	17-28	12
α-helix	35-40	6
α-helix	42-51	10
α-helix	58-60	3
α-helix	68-85	18
α-helix	93-96	4
α-helix	101-118	18
α-helix	126-129	4

Chain B: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	17-28	12
α-helix	35-40	6
α-helix	42-51	10
α-helix	58-60	3
α-helix	68-85	18
α-helix	93-96	4
α-helix	101-118	18
α-helix	126-129	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Microtubule-associated protein RP/EB family member 1	A, B	protein	123	Homo sapiens	Q15691 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2QJZ_1 Microtubule-associated protein RP/EB family member 1 (chains A, B)
GSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHE
YIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKDYDPVAAR
QGQ

Primary citation

Structural Basis of Microtubule Plus End Tracking by XMAP215, CLIP-170, and EB1. Slep, K.C., Vale, R.D. Mol Cell (2007) 27:976-991. DOI 10.1016/j.molcel.2007.07.023 · PubMed

Other PDB entries of the same protein (UniProt Q15691 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2R8U 1.35 Å, Structure of fragment of human end-binding protein 1 (EB1) containing the N-terminal…
1PA7 1.45 Å, Crystal structure of amino-terminal microtubule binding domain of EB1
1WU9 1.54 Å, Crystal structure of the C-terminal domain of the end-binding protein 1 (EB1)
5JVM 1.57 Å, The neck-linker and alpha 7 helix of Mus musculus KIF3C
1VKA 1.6 Å, Southeast Collaboratory for Structural Genomics: Hypothetical Human Protein Q15691…
5JX1 1.67 Å, The neck-linker and alpha 7 helix of Mus musculus KIF3A fused to EB1
1TXQ 1.8 Å, Crystal structure of the EB1 C-terminal domain complexed with the CAP-Gly domain of…
1YIB 1.8 Å, Crystal Structure of the Human EB1 C-terminal Dimerization Domain
6YF5 1.83 Å, Lamin A 17-70 coil1A dimer stabilized by C-terminal capping
2HKQ 1.86 Å, Crystal structure of the C-terminal domain of human EB1 in complex with the CAP-Gly…
2HL5 1.93 Å, Crystal structure of the C-terminal domain of human EB1 in complex with the A49M mutant…
5JVU 1.95 Å, The neck-linker and alpha 7 helix of Drosophila melanogaster kinesin-1 fused to EB1

Browse structure collections

About this viewer

MolViewer shows 2QJZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.