2QLD: Human Hsp40 Hdj1

human Hsp40 Hdj1. Determined by X-ray diffraction at 2.7 Å resolution. Released 15 Jul 2008.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,359
Mol. weight: 20.74 kDa
Released: 15 Jul 2008

Explore 2QLD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2QLD contains 10 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	164-170	7	1
α-helix	172-177	6
β-strand	179-186	8	2
β-strand	201-208	8	2
α-helix	212-213	2
β-strand	217-220	4	1
β-strand	235-241	7	1
α-helix	242-244	3
β-strand	248-250	3	3
β-strand	253-261	9	3
α-helix	262-267	6
β-strand	269-274	6	4
α-helix	275	1
β-strand	280-285	6	4
α-helix	288-290	3
β-strand	294-297	4	3
α-helix	302	1
β-strand	303	1	5
α-helix	304	1
β-strand	311	1	5
β-strand	314-321	8	3
α-helix	322-323	2
α-helix	328-333	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DnaJ homolog subfamily B member 1	A	protein	183	Homo sapiens	P25685 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2QLD_1 DnaJ homolog subfamily B member 1 (chains A)
KKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKKGWKEGTK
ITFPKEGDQTSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLD
GRTIPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQV
LPI

Primary citation

The crystal structure of the putative peptide-binding fragment from the human Hsp40 protein Hdj1. Hu, J., Wu, Y., Li, J. et al. BMC Struct Biol (2008) 8:3-3. DOI 10.1186/1472-6807-8-3 · PubMed

Other PDB entries of the same protein (UniProt P25685 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3AGX 1.85 Å, Crystal structure of human Hsp40 Hdj1 peptide-binding domain
3AGY 1.85 Å, Crystal structure of human Hsp40 Hdj1 peptide-binding domain complexed with a C-terminal…
4WB7 1.9 Å, Crystal structure of a chimeric fusion of human DnaJ (Hsp40) and cAMP-dependent protein…
8FE2 2.34 Å, Structure of J-PKAc chimera complexed with Aplithianine A
9NFS 2.45 Å, Structure of J-PKAc chimera in complex with Aplithianine j1
3AGZ 2.51 Å, Crystal structure of human Hsp40 Hdj1 peptide-binding domain complexed with a C-terminal…
8FE5 2.51 Å, Structure of J-PKAc chimera complexed with Aplithianine B
7NDX 2.54 Å, Crystal structure of the human HSP40 DNAJB1-CTDs in complex with a peptide of NudC
8FEC 2.7 Å, Structure of J-PKAc chimera complexed with Aplithianine derivative
6BYR 3.66 Å, Structures of the PKA RI alpha holoenzyme with the FLHCC driver J-PKAc alpha or native…
6WJG 6.2 Å, PKA RIIbeta holoenzyme with DnaJB1-PKAc fusion in fibrolamellar hepatoceullar carcinoma
6WJF 7.5 Å, PKA RIIbeta holoenzyme with DnaJB1-PKAc fusion in fibrolamellar hepatoceullar carcinoma

Browse structure collections

About this viewer

MolViewer shows 2QLD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.