Human EphA3 kinase and juxtamembrane region, phosphorylated, AMP-PNP bound. Determined by X-ray diffraction at 1.55 Å resolution. Released 21 Aug 2007.
Explore 2QO9 in 3D Show helices and sheets RCSB PDB PDBe
2QO9 contains 20 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 609-611 | 3 | |
| α-helix | 614 | 1 | |
| β-strand | 615 | 1 | 1 |
| α-helix | 616-617 | 2 | |
| α-helix | 618-620 | 3 | |
| β-strand | 621-630 | 10 | 1 |
| β-strand | 633-641 | 9 | 1 |
| β-strand | 647-654 | 8 | 1 |
| α-helix | 655-656 | 2 | |
| α-helix | 661-674 | 14 | |
| β-strand | 682 | 1 | 2 |
| β-strand | 685-689 | 5 | 1 |
| β-strand | 696-700 | 5 | 1 |
| β-strand | 706 | 1 | 2 |
| α-helix | 707-712 | 6 | |
| α-helix | 720-739 | 20 | |
| β-strand | 742-743 | 2 | 3 |
| α-helix | 749-751 | 3 | |
| β-strand | 752-754 | 3 | 2 |
| β-strand | 760-762 | 3 | 2 |
| β-strand | 769-770 | 2 | 3 |
| α-helix | 788-790 | 3 | |
| α-helix | 793-798 | 6 | |
| α-helix | 803-818 | 16 | |
| α-helix | 822-823 | 2 | |
| α-helix | 830-838 | 9 | |
| β-strand | 841-842 | 2 | 4 |
| α-helix | 843-846 | 4 | |
| β-strand | 850 | 1 | 5 |
| α-helix | 851-860 | 10 | |
| α-helix | 865-867 | 3 | |
| α-helix | 869-870 | 2 | |
| α-helix | 871-883 | 13 | |
| α-helix | 885-889 | 5 | |
| β-strand | 891 | 1 | 5 |
| β-strand | 902-903 | 2 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ephrin receptor | A | protein | 373 | Homo sapiens | P29320 (AlphaFold model) |
>2QO9_1 Ephrin receptor (chains A) GSDEKRLHFGNGHLKLPGLRTYVDPHTYEDPTQTVHEFAKELDATNISIDKVVGAGEFGE VCSGRLKLPSKKEISVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKP VMIVTEYMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILI NSNLVCKVSDFGLSRVLEDDPEAAYTTRGGKIPIRWTSPEAIAYRKFTSASDVWSYGIVL WEVMSYGERPYWEMSNQDVIKAVDEGYRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQI VSILDKLIRNPGSLKIITSAAARPSNLLLDQSNVDITTFRTTGDWLNGVWTAHCKEIFTG VEYSSCDTIAKIS
| ID | Name | Formula | Copies |
|---|---|---|---|
| ANP | Phosphoaminophosphonic acid-adenylate ester | C10 H17 N6 O12 P3 | 1 |
| MG | Magnesium ion | Mg | 1 |
Autoregulation by the Juxtamembrane Region of the Human Ephrin Receptor Tyrosine Kinase A3 (EphA3). Davis, T.L., Walker, J.R., Loppnau, P. et al. Structure (2008) 16:873-884. DOI 10.1016/j.str.2008.03.008 · PubMed
Other PDB entries of the same protein (UniProt P29320 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2QO9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.