Human EphA3 Kinase domain in complex with quinoxaline derivatives. Determined by X-ray diffraction at 1.6 Å resolution. Released 13 Aug 2014.
Explore 4P4C in 3D Show helices and sheets RCSB PDB PDBe
4P4C contains 20 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 614 | 1 | |
| β-strand | 615 | 1 | 1 |
| α-helix | 616-617 | 2 | |
| α-helix | 618-620 | 3 | |
| β-strand | 621-629 | 9 | 1 |
| β-strand | 634-641 | 8 | 1 |
| β-strand | 647-654 | 8 | 1 |
| α-helix | 655-656 | 2 | |
| α-helix | 661-674 | 14 | |
| β-strand | 682 | 1 | 2 |
| α-helix | 683-684 | 2 | |
| β-strand | 685-689 | 5 | 1 |
| β-strand | 696-700 | 5 | 1 |
| β-strand | 706 | 1 | 2 |
| α-helix | 707-712 | 6 | |
| α-helix | 720-739 | 20 | |
| α-helix | 749-751 | 3 | |
| β-strand | 752-754 | 3 | 2 |
| β-strand | 760-762 | 3 | 2 |
| α-helix | 788-790 | 3 | |
| α-helix | 793-798 | 6 | |
| α-helix | 803-818 | 16 | |
| α-helix | 822-823 | 2 | |
| α-helix | 830-838 | 9 | |
| β-strand | 841-842 | 2 | 3 |
| α-helix | 843-846 | 4 | |
| β-strand | 850 | 1 | 4 |
| α-helix | 851-860 | 10 | |
| α-helix | 865-867 | 3 | |
| α-helix | 869-870 | 2 | |
| α-helix | 871-883 | 13 | |
| α-helix | 885-889 | 5 | |
| β-strand | 891 | 1 | 4 |
| β-strand | 902-903 | 2 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| EPH receptor A3 | A | protein | 361 | Homo sapiens | P29320 (AlphaFold model) |
>4P4C_1 EPH receptor A3 (chains A) MGSSHHHHHHSSGLVPRGSTQTVHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKK EISVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGS LDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFG LSRVLEDDPEAAYTTRGGKIPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYW EMSNQDVIKAVDEGYRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPG SLKIITSAAARPSNLLLDQSNVDITTFRTTGDWLNGVWTAHCKEIFTGVEYSSCDTIAKI S
| ID | Name | Formula | Copies |
|---|---|---|---|
| 25Q | 2-amino-1-(3-methoxyphenyl)-1H-pyrrolo[2,3-b]quinoxaline-3-carboxamide | C18 H15 N5 O2 | 1 |
Pyrrolo[3,2-b]quinoxaline Derivatives as Types I1/2 and II Eph Tyrosine Kinase Inhibitors: Structure-Based Design, Synthesis, and in Vivo Validation. Unzue, A., Dong, J., Lafleur, K. et al. J Med Chem (2014) 57:6834-6844. DOI 10.1021/jm5009242 · PubMed
Other PDB entries of the same protein (UniProt P29320 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4P4C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.