2QOC: Ephrin receptor

Human EphA3 kinase domain, phosphorylated, AMP-PNP bound structure. Determined by X-ray diffraction at 1.25 Å resolution. Released 21 Aug 2007.

Method: X-ray diffraction
Resolution: 1.25 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,952
Mol. weight: 39.2 kDa
Ligands: MG, ANP
Released: 21 Aug 2007

Explore 2QOC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2QOC contains 19 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	614	1
β-strand	615	1	1
α-helix	616-617	2
α-helix	618-620	3
β-strand	621-629	9	1
β-strand	634-641	8	1
β-strand	647-654	8	1
α-helix	655-656	2
α-helix	661-674	14
β-strand	682	1	2
β-strand	685-689	5	1
β-strand	696-700	5	1
β-strand	706	1	2
α-helix	707-712	6
α-helix	720-739	20
β-strand	742-743	2	3
α-helix	749-751	3
β-strand	752-754	3	2
β-strand	760-762	3	2
β-strand	769-770	2	3
α-helix	788-790	3
α-helix	793-798	6
α-helix	803-818	16
α-helix	822-823	2
α-helix	830-838	9
β-strand	841-842	2	4
α-helix	843-846	4
β-strand	850	1	5
α-helix	851-860	10
α-helix	865-867	3
α-helix	869-870	2
α-helix	871-883	13
α-helix	885-889	5
β-strand	891	1	5
β-strand	902-903	2	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ephrin receptor	A	protein	344	Homo sapiens	P29320 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2QOC_1 Ephrin receptor (chains A)
GSTQTVHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGYTEKQ
RRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTVIQL
VGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYTTRG
GKIPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEGYRL
PPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITSAAARPSNLLL
DQSNVDITTFRTTGDWLNGVWTAHCKEIFTGVEYSSCDTIAKIS

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	2
ANP	Phosphoaminophosphonic acid-adenylate ester	C10 H17 N6 O12 P3	1

Water and common crystallization additives (BME) are not listed.

Primary citation

Autoregulation by the Juxtamembrane Region of the Human Ephrin Receptor Tyrosine Kinase A3 (EphA3). Davis, T.L., Walker, J.R., Loppnau, P. et al. Structure (2008) 16:873-884. DOI 10.1016/j.str.2008.03.008 · PubMed

Other PDB entries of the same protein (UniProt P29320 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2QOL 1.07 Å, Human EphA3 kinase and juxtamembrane region, Y596:Y602:S768G triple mutant
2QOD 1.15 Å, Human EphA3 kinase and juxtamembrane region, Y602F mutant
2QOF 1.2 Å, Human EphA3 kinase and juxtamembrane region, Y596F mutant
2QOK 1.2 Å, Human EphA3 kinase and juxtamembrane region, Y596F:Y602F:S768A triple mutant
2QOI 1.25 Å, Human EphA3 kinase and juxtamembrane region, Y596F:Y602F double mutant
2QOO 1.25 Å, Human EphA3 kinase and juxtamembrane region, Y596F:Y602F:Y742F triple mutant
4P5Q 1.35 Å, Human EphA3 Kinase domain in complex with quinoxaline derivatives
6IN0 1.5 Å, Crystal structure of EphA3 in complex with 18-Crown-6
2QO9 1.55 Å, Human EphA3 kinase and juxtamembrane region, phosphorylated, AMP-PNP bound
4P4C 1.6 Å, Human EphA3 Kinase domain in complex with quinoxaline derivatives
2QO2 1.6 Å, Human EphA3 kinase and juxtamembrane region, dephosphorylated, apo structure
2QOQ 1.6 Å, Human EphA3 kinase and juxtamembrane region, base, AMP-PNP bound structure

Browse structure collections

About this viewer

MolViewer shows 2QOC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.