2QSH: Rad4-Rad23

Crystal structure of Rad4-Rad23 bound to a mismatch DNA. Determined by X-ray diffraction at 2.81 Å resolution. Released 2 Oct 2007.

Method: X-ray diffraction
Resolution: 2.81 Å
Organism: Saccharomyces cerevisiae
Chains: 4
Atoms: 5,485
Mol. weight: 95.09 kDa
Released: 2 Oct 2007

Explore 2QSH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2QSH contains 37 α-helices and 23 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 32 helices, 23 β-strands

Element	Residues	Length	Sheet
α-helix	124-129	6
α-helix	134-162	29
α-helix	165-172	8
α-helix	177-183	7
α-helix	185-187	3
α-helix	193-213	21
β-strand	216-217	2	1
α-helix	218-220	3
α-helix	227-229	3
α-helix	230-236	7
α-helix	248-257	10
β-strand	259-260	2	1
α-helix	262-275	14
β-strand	280-285	6	2
α-helix	305-309	5
β-strand	315-321	7	2
β-strand	326-331	6	2
β-strand	337-339	3	2
α-helix	354-356	3
β-strand	363-366	4	2
β-strand	372-374	3	2
α-helix	376-379	4
α-helix	387-390	4
α-helix	392-394	3
α-helix	396-409	14
α-helix	416-432	17
α-helix	439-441	3
β-strand	447-449	3	3
α-helix	450-452	3
β-strand	457-459	3	4
α-helix	460	1
β-strand	467-470	4	3
β-strand	478-483	6	3
α-helix	484-486	3
β-strand	487-489	3	4
β-strand	491	1	5
α-helix	493-497	5
β-strand	501-503	3	6
α-helix	504	1
β-strand	511-513	3	7
β-strand	529-531	3	7
β-strand	532	1	5
α-helix	534-536	3
β-strand	537-539	3	6
α-helix	542-546	5
α-helix	550-552	3
β-strand	559-560	2	8
α-helix	564-566	3
β-strand	571-575	5	8
α-helix	579-586	8
β-strand	590-599	10	8
β-strand	605-615	11	8
α-helix	616-618	3
α-helix	619-627	9
α-helix	629-631	3

Chain X: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	259-271	13
α-helix	273-275	3
α-helix	276-286	11
α-helix	288-296	9
α-helix	298-306	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
top strand of the mismatch DNA	W	DNA	24
bottom strand of the mismatch DNA	Y	DNA	24
DNA repair protein RAD4	A	protein	538	Saccharomyces cerevisiae	P14736 (AlphaFold model)
UV excision repair protein RAD23	X	protein	171	Saccharomyces cerevisiae	P32628 (AlphaFold model)

Sequence of entity 1 (W), FASTA

>2QSH_1 top strand of the mismatch DNA (chains W)
TTGACTCAACATCCTTTGCTACAA

Sequence of entity 2 (Y), FASTA

>2QSH_2 bottom strand of the mismatch DNA (chains Y)
ATTGTAGCTTTGGATGTTGAGTCA

Sequence of entity 3 (A), FASTA

>2QSH_3 DNA repair protein RAD4 (chains A)
GSSRAMGNEVAGVEDISVEIKPSSKRNSDARRTSRNVCSNEERKRRKYFHMLYLVCLMVH
GFIRNEWINSKRLSRKLSNLVPEKVFELLHPQKDEELPLRSTRKLLDGLKKCMELWQKHW
KITKKYDNEGLYMRTWKEIEMSANNKRKFKTLKRSDFLRAVSKGHGDPDISVQGFVAMLR
ACNVNARLIMSCQPPDFTNMKIDTSLNGNNAYKDMVKYPIFWCEVWDKFSKKWITVDPVN
LKTIEQVRLHSKLAPKGVACCERNMLRYVIAYDRKYGCRDVTRRYAQWMNSKVRKRRITK
DDFGEKWFRKVITALHHRKRTKIDDYEDQYFFQRDESEGIPDSVQDLKNHPYYVLEQDIK
QTQIVKPGCKECGYLKVHGKVGKVLKVYAKRDIADLKSARQWYMNGRILKTGSRCKKVIK
RTVGRPKGEAEEEDERLYSFEDTELYIPPLASASGEITKNTFGNIEVFAPTMIPGNCCLV
ENPVAIKAARFLGVEFAPAVTSFKFERGSTVKPVLSGIVVAKWLREAIETAIDGIEFI

Sequence of entity 4 (X), FASTA

>2QSH_4 UV excision repair protein RAD23 (chains X)
GSGNASSGALGTTGGATDAAQGGPPGSIGLTVEDLLSLRQVVSGNPEALAPLLENISARY
PQLREHIMANPEVFVSMLLEAVGDNMQDVMEGADDMVEGEDIEVTGEAAAAGLGQGEGEG
SFQVDYTPEDDQAISRLCELGFERDLVIQVYFACDKNEEAAANILFSDHAD

Primary citation

Recognition of DNA damage by the Rad4 nucleotide excision repair protein. Min, J.-H., Pavletich, N.P. Nature (2007) 449:570-575. DOI 10.1038/nature06155 · PubMed

Other PDB entries of the same protein (UniProt P14736 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2QSF 2.35 Å, Crystal structure of the Rad4-Rad23 complex
6UG1 2.83 Å, Sequence impact in DNA duplex opening by the Rad4/XPC nucleotide excision repair complex
4YIR 3.05 Å, Crystal structure of Rad4-Rad23 crosslinked to an undamaged DNA
2QSG 3.1 Å, Crystal structure of Rad4-Rad23 bound to a UV-damaged DNA
6UIN 3.35 Å, Role of Beta-hairpin motifs in the DNA duplex opening by the Rad4/XPC nucleotide…
6CFI 3.36 Å, Crystal structure of Rad4-Rad23 bound to a 6-4 photoproduct UV lesion
6UBF 4.6 Å, Role of Beta-hairpin motifs in the DNA duplex opening by the Rad4/XPC nucleotide…
7M2U 8.2 Å, Nucleotide Excision Repair complex TFIIH Rad4-33
7K04 9.25 Å, Structure of TFIIH/Rad4-Rad23-Rad33/DNA in DNA opening
2M14 NMR structure of the complex between the PH domain of the Tfb1 subunit from TFIIH and Rad4

Browse structure collections

About this viewer

MolViewer shows 2QSH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.