Crystal structure of the V39C mutant of the N-terminal domain of carcinoembryonic antigen (CEA). Determined by X-ray diffraction at 2.9 Å resolution. Released 1 Jan 2008.
Explore 2QST in 3D Show helices and sheets RCSB PDB PDBe
2QST contains 4 α-helices and 23 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-7 | 5 | 1 |
| β-strand | 10-12 | 3 | 2 |
| β-strand | 17-22 | 6 | 1 |
| β-strand | 28-35 | 8 | 3 |
| α-helix | 41-43 | 3 | |
| β-strand | 44-49 | 6 | 3 |
| β-strand | 54-57 | 4 | 3 |
| β-strand | 65-67 | 3 | 1 |
| β-strand | 73-75 | 3 | 1 |
| α-helix | 80-82 | 3 | |
| β-strand | 84-92 | 9 | 3 |
| β-strand | 98-104 | 7 | 3 |
| β-strand | 105-107 | 3 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-7 | 5 | 4 |
| β-strand | 10-12 | 3 | 5 |
| β-strand | 17-22 | 6 | 4 |
| α-helix | 24-25 | 2 | |
| β-strand | 28-35 | 8 | 6 |
| β-strand | 44-49 | 6 | 6 |
| β-strand | 54 | 1 | 1 |
| β-strand | 55-57 | 3 | 6 |
| β-strand | 65-67 | 3 | 4 |
| β-strand | 73-75 | 3 | 4 |
| α-helix | 80-82 | 3 | |
| β-strand | 84-92 | 9 | 6 |
| β-strand | 97-104 | 8 | 6 |
| β-strand | 105-107 | 3 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Carcinoembryonic antigen-related cell adhesion molecule 5 | A, B | protein | 111 | Homo sapiens | P06731 (AlphaFold model) |
>2QST_1 Carcinoembryonic antigen-related cell adhesion molecule 5 (chains A, B) AKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERCDGNRQIIGYVIGTQQATPGP AYSGREIIYPNASLLIQNIIQNDAGFYTLHVIKSDLVNEEATGQFRVYPEL
Binding of Dr adhesins of Escherichia coli to carcinoembryonic antigen triggers receptor dissociation. Korotkova, N., Yang, Y., Le Trong, I. et al. Mol Microbiol (2008) 67:420-434. DOI 10.1111/j.1365-2958.2007.06054.x · PubMed
Other PDB entries of the same protein (UniProt P06731 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2QST directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.