2QWC: Neuraminidase

The X-ray structure of a complex of NEU5AC2EN and a drug resistant variant R292K of tern N9 influenza virus neuraminidase. Determined by X-ray diffraction at 1.6 Å resolution. Released 11 Nov 1998.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Influenza A virus
Chains: 1
Atoms: 3,602
Mol. weight: 45.95 kDa
Ligands: DAN, CA, NAG
Released: 11 Nov 1998

Explore 2QWC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2QWC contains 7 α-helices and 29 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 29 β-strands

Element	Residues	Length	Sheet
α-helix	89	1
β-strand	90-91	2	1
α-helix	92-93	2
β-strand	96-102	7	2
α-helix	105-109	5
β-strand	114	1	3
β-strand	115-125	11	4
β-strand	128-139	12	4
α-helix	143-145	3
β-strand	157-162	6	4
β-strand	168	1	3
α-helix	171	1
β-strand	172-176	5	4
β-strand	179-184	6	5
β-strand	189-195	7	5
β-strand	202-207	6	5
β-strand	210-216	7	5
β-strand	224	1	6
β-strand	233	1	6
β-strand	236-244	9	6
β-strand	250-258	9	6
β-strand	261-267	7	6
β-strand	276-283	8	7
β-strand	286-292	7	7
α-helix	300	1
β-strand	301-306	6	7
β-strand	311-316	6	7
β-strand	353-354	2	8
β-strand	361-364	4	8
β-strand	372-378	7	8
β-strand	392-403	11	8
β-strand	407-410	4	2
β-strand	417-418	2	1
β-strand	421-429	9	2
β-strand	439-449	11	2
α-helix	464-467	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Neuraminidase	A	protein	388	Influenza A virus	P03472

Sequence of entity 1 (A), FASTA

>2QWC_1 NEURAMINIDASE (chains A)
RDFNNLTKGLCTINSWHIYGKDNAVRIGEDSDVLVTREPYVSCDPDECRFYALSQGTTIR
GKHSNGTIHDRSQYRALISWPLSSPPTVYNSRVECIGWSSTSCHDGKTRMSICISGPNNN
ASAVIWYNRRPVTEINTWARNILRTQESECVCHNGVCPVVFTDGSATGPAETRIYYFKEG
KILKWEPLAGTAKHIEECSCYGERAEITCTCKDNWQGSNRPVIRIDPVAMTHTSQYICSP
VLTDNPRPNDPTVGKCNDPYPGNNNNGVKGFSYLDGVNTWLGRTISIASRSGYEMLKVPN
ALTDDKSKPTQGQTIVLNTDWSGYSGSFMDYWAEGECYRACFYVELIRGRPKEDKVWWTS
NSIVSMCSSTEFLGQWDWPDGAKIEYFL

Ligands and cofactors

ID	Name	Formula	Copies
DAN	2-deoxy-2,3-dehydro-N-acetyl-neuraminic acid	C11 H17 N O8	1
CA	Calcium ion	Ca	2
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	1

Primary citation

Drug design against a shifting target: a structural basis for resistance to inhibitors in a variant of influenza virus neuraminidase. Varghese, J.N., Smith, P.W., Sollis, S.L. et al. Structure (1998) 6:735-746. DOI 10.1016/S0969-2126(98)00075-6 · PubMed

Other PDB entries of the same protein (UniProt P03472), best resolution first:

6HFC 1.29 Å, Influenza A Virus N9 Neuraminidase Native (Tern).
6HCX 1.3 Å, Influenza Virus N9 Neuraminidase A complex with Zanamivir molecule (Tern).
6HG0 1.3 Å, Influenza A Virus N9 Neuraminidase complex with NANA (Tern/Australia).
1F8D 1.4 Å, Native Influenza Neuraminidase in Complex with 9-amino-2-deoxy-2,3-dehydro-N-neuraminic…
1F8E 1.4 Å, Native Influenza Neuraminidase in Complex with 4,9-diamino-2-deoxy-2,3-dehydro-N-acetyl-n…
6D3B 1.4 Å, Influenza virus neuraminidase subtype N9 (TERN) apo form
4DGR 1.55 Å, Influenza Subtype 9 Neuraminidase Benzoic Acid Inhibitor Complex
1F8C 1.7 Å, Native Influenza Neuraminidase in Complex with 4-amino-2-deoxy-2,3-dehydro-N-neuraminic…
1MWE 1.7 Å, The X-ray structure of a complex of tern N9 influenza virus neuraminidase complexed with…
2QWA 1.7 Å, The X-ray structure of a drug resistant variant R292K of tern N9 influenza virus…
6HEB 1.75 Å, Influenza A Virus N9 Neuraminidase complex with Oseltamivir (Tern).
1F8B 1.8 Å, Native Influenza Virus Neuraminidase in Complex with NEU5AC2EN

Browse structure collections

About this viewer

MolViewer shows 2QWC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.