Crystal Structure of Autoinhibited Form of Grp1 Arf GTPase Exchange Factor. Determined by X-ray diffraction at 1.9 Å resolution. Released 4 Dec 2007.
Explore 2R09 in 3D Show helices and sheets RCSB PDB PDBe
2R09 contains 34 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 60-62 | 3 | |
| α-helix | 64-79 | 16 | |
| α-helix | 81-90 | 10 | |
| α-helix | 98-107 | 10 | |
| α-helix | 113-121 | 9 | |
| α-helix | 125-136 | 12 | |
| α-helix | 145-152 | 8 | |
| α-helix | 162-179 | 18 | |
| α-helix | 187-205 | 19 | |
| α-helix | 212-214 | 3 | |
| α-helix | 215-221 | 7 | |
| β-strand | 226 | 1 | 1 |
| β-strand | 229 | 1 | 1 |
| α-helix | 230-232 | 3 | |
| α-helix | 233-245 | 13 | |
| α-helix | 247-249 | 3 | |
| α-helix | 258-260 | 3 | |
| β-strand | 267-274 | 8 | 2 |
| β-strand | 281-289 | 9 | 2 |
| β-strand | 292-296 | 5 | 2 |
| β-strand | 306-309 | 4 | 2 |
| β-strand | 314-318 | 5 | 2 |
| β-strand | 326-330 | 5 | 2 |
| α-helix | 337-340 | 4 | |
| β-strand | 342-344 | 3 | 2 |
| β-strand | 350-352 | 3 | 2 |
| β-strand | 358-361 | 4 | 2 |
| α-helix | 365-380 | 16 | |
| α-helix | 383-395 | 13 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 61-79 | 19 | |
| α-helix | 81-90 | 10 | |
| α-helix | 98-107 | 10 | |
| α-helix | 113-120 | 8 | |
| α-helix | 125-136 | 12 | |
| α-helix | 145-152 | 8 | |
| α-helix | 162-179 | 18 | |
| α-helix | 187-205 | 19 | |
| α-helix | 215-221 | 7 | |
| β-strand | 226 | 1 | 3 |
| β-strand | 229 | 1 | 3 |
| α-helix | 230-232 | 3 | |
| α-helix | 233-245 | 13 | |
| α-helix | 247-249 | 3 | |
| α-helix | 258-260 | 3 | |
| β-strand | 267-274 | 8 | 4 |
| β-strand | 281-289 | 9 | 4 |
| β-strand | 292-296 | 5 | 4 |
| β-strand | 306-309 | 4 | 4 |
| β-strand | 314-318 | 5 | 4 |
| β-strand | 326-330 | 5 | 4 |
| α-helix | 337-339 | 3 | |
| β-strand | 342-344 | 3 | 4 |
| β-strand | 350-352 | 3 | 4 |
| β-strand | 357-361 | 5 | 4 |
| α-helix | 365-380 | 16 | |
| α-helix | 382-393 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cytohesin-3 | A, B | protein | 347 | Mus musculus | O08967 (AlphaFold model) |
>2R09_1 Cytohesin-3 (chains A, B) MGHHHHHHGSTTQRNAQIAMGRKKFNMDPKKGIQFLIENDLLQSSPEDVAQFLYKGEGLN KTVIGDYLGERDDFNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAF ASRYCLCNPGVFQSTDTCYVLSFAIIMLNTSLHNHNVRDKPTAERFITMNRGINEGGDLP EELLRNLYESIKNEPFKIPEDDGNDLTYTFFNPDREGWLLKLGGRVKTWKRRWFILTDNC LYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVE GNHVVYRISAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRIANKK
| ID | Name | Formula | Copies |
|---|---|---|---|
| PE5 | 3,6,9,12,15,18,21,24-octaoxahexacosan-1-ol | C18 H38 O9 | 1 |
| 4IP | Inositol-(1,3,4,5)-tetrakisphosphate | C6 H16 O18 P4 | 2 |
Water and common crystallization additives (PGE, SO4) are not listed.
Structural Basis and Mechanism of Autoregulation in 3-Phosphoinositide-Dependent Grp1 Family Arf GTPase Exchange Factors. DiNitto, J.P., Delprato, A., Gabe Lee, M.T. et al. Mol Cell (2007) 28:569-583. DOI 10.1016/j.molcel.2007.09.017 · PubMed
Other PDB entries of the same protein (UniProt O08967 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2R09 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.