Model for extended volume of truncated monomeric Cytohesin-3 (Grp1; amino acids 63-399) E161A Arf6 Q67L fusion protein. Determined by electron microscopy at 35.0 Å resolution. Released 10 Jan 2018.
Explore 6BBQ in 3D Show helices and sheets RCSB PDB PDBe
6BBQ contains 26 α-helices and 21 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 62-79 | 18 | |
| α-helix | 81-90 | 10 | |
| α-helix | 98-107 | 10 | |
| α-helix | 113-121 | 9 | |
| α-helix | 125-136 | 12 | |
| α-helix | 145-152 | 8 | |
| α-helix | 162-179 | 18 | |
| α-helix | 187-205 | 19 | |
| α-helix | 212-214 | 3 | |
| α-helix | 215-221 | 7 | |
| β-strand | 226 | 1 | 1 |
| β-strand | 229 | 1 | 1 |
| α-helix | 230-232 | 3 | |
| α-helix | 233-245 | 13 | |
| α-helix | 247-249 | 3 | |
| α-helix | 264-265 | 2 | |
| β-strand | 267-274 | 8 | 2 |
| β-strand | 281-289 | 9 | 2 |
| β-strand | 292-296 | 5 | 2 |
| β-strand | 306-309 | 4 | 2 |
| β-strand | 311 | 1 | 3 |
| β-strand | 314-318 | 5 | 2 |
| β-strand | 326-330 | 5 | 2 |
| α-helix | 337-340 | 4 | |
| β-strand | 342-344 | 3 | 2 |
| β-strand | 350-352 | 3 | 2 |
| β-strand | 358-361 | 4 | 2 |
| α-helix | 365-378 | 14 | |
| β-strand | 380 | 1 | 3 |
| α-helix | 383-394 | 12 | |
| α-helix | 399-407 | 9 | |
| β-strand | 411-417 | 7 | 4 |
| α-helix | 424-433 | 10 | |
| β-strand | 445-452 | 8 | 4 |
| β-strand | 455-462 | 8 | 4 |
| α-helix | 466-475 | 10 | |
| β-strand | 481-487 | 7 | 4 |
| α-helix | 491-493 | 3 | |
| α-helix | 494-505 | 12 | |
| α-helix | 508-510 | 3 | |
| β-strand | 514-520 | 7 | 4 |
| α-helix | 527-529 | 3 | |
| α-helix | 530-536 | 7 | |
| β-strand | 547-551 | 5 | 4 |
| β-strand | 553 | 1 | 5 |
| β-strand | 558 | 1 | 5 |
| α-helix | 560-570 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cytohesin-3,ADP-ribosylation factor 6 | A | protein | 520 | Mus musculus, Homo sapiens | O08967 (AlphaFold model), P62330 (AlphaFold model) |
>6BBQ_1 Cytohesin-3,ADP-ribosylation factor 6 (chains A) MGHHHHHHGSTTQRNKQIAMGRKKFNMDPKKGIQFLIENDLLQSSPEDVAQFLYKGEGLN KTVIGDYLGERDDFNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAF ASRYCLCNPGVFQSTDTCYVLSFAIIMLNTSLHNHNVRDKPTAERFITMNRGINEGGDLP EELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNC LYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVE GNHVVYRISAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRIANKKGKVLSKIFGNKEM RILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGLDKIRPLW RHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHE IQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYK
| ID | Name | Formula | Copies |
|---|---|---|---|
| 4IP | Inositol-(1,3,4,5)-tetrakisphosphate | C6 H16 O18 P4 | 1 |
| MG | Magnesium ion | Mg | 1 |
| GTP | Guanosine-5'-triphosphate | C10 H16 N5 O14 P3 | 1 |
Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors. Malaby, A.W., Das, S., Chakravarthy, S. et al. Structure (2018) 26:106-117.e6. DOI 10.1016/j.str.2017.11.019 · PubMed
Other PDB entries of the same protein (UniProt O08967 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6BBQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.