2R4H: PDB entry 2R4H

Crystal structure of a C1190S mutant of the 6th PDZ domain of human membrane associated guanylate kinase. Determined by X-ray diffraction at 2.05 Å resolution. Released 16 Oct 2007.

Method: X-ray diffraction
Resolution: 2.05 Å
Organism: Homo sapiens
Chains: 3
Atoms: 2,284
Mol. weight: 39.27 kDa
Ligands: HIS
Released: 16 Oct 2007

Explore 2R4H in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2R4H contains 13 α-helices and 25 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	3-9	7	1
β-strand	11	1	2
β-strand	14	1	2
β-strand	17-21	5	1
α-helix	23-25	3
β-strand	29-34	6	1
α-helix	39-42	4
β-strand	51-55	5	1
β-strand	58-59	2	1
α-helix	65-73	9
β-strand	78-84	7	1
β-strand	87-89	3	3

Chain B: 5 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	3-9	7	4
β-strand	11	1	5
β-strand	14	1	5
β-strand	17-22	6	4
α-helix	23-25	3
β-strand	27-34	8	4
α-helix	39-42	4
α-helix	50	1
β-strand	51-55	5	4
β-strand	58-59	2	4
α-helix	65-74	10
β-strand	78-84	7	4
α-helix	85-86	2

Chain C: 5 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	-6-2	9
β-strand	3-9	7	3
β-strand	11	1	6
β-strand	14	1	6
β-strand	17-22	6	3
α-helix	23-25	3
β-strand	27-34	8	3
α-helix	39-43	5
α-helix	50	1
β-strand	51-55	5	3
β-strand	58-59	2	3
α-helix	65-74	10
β-strand	78-84	7	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1	A, B, C	protein	112	Homo sapiens	Q96QZ7 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>2R4H_1 Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 (chains A, B, C)
MHHHHHHSSGVDLGTENLYFQSMDFYTVELERGAKGFGFSLRGGREYNMDLYVLRLAEDG
PAERSGKMRIGDEILEINGETTKNMKHSRAIELIKNGGRRVRLFLKRGETSV

Ligands and cofactors

ID	Name	Formula	Copies
HIS	Histidine	C6 H10 N3 O2	5

Primary citation

Crystal structure of a C1190S mutant of the 6th PDZ domain of human membrane associated guanylate kinase. Ugochukwu, E., Pilka, E.S., Hozjan, V. et al. To be published.

Other PDB entries of the same protein (UniProt Q96QZ7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3BPU 1.6 Å, Crystal structure of the 3rd PDZ domain of human membrane associated guanylate kinase,…
2Q9V 2.0 Å, Crystal structure of the C890S mutant of the 4th PDZ domain of human membrane associated…
5N7D 2.3 Å, MAGI-1 complexed with a RSK1 peptide
5N7F 2.3 Å, MAGI-1 complexed with a pRSK1 peptide
6TWX 2.3 Å, MAGI1_2 complexed with a phosphorylated 16E6 peptide
6TWY 2.3 Å, MAGI1_2 complexed with a phosphomimetic RSK1 peptide
1WBP 2.4 Å, SRPK1 bound to 9mer docking motif peptide
6TWU 2.4 Å, MAGI1_2 complexed with a phosphomimetic 16E6 peptide
7P71 2.6 Å, The PDZ domain of MAGI1_2 complexed with the PDZ-binding motif of HPV35-E6
5N7G 2.95 Å, MAGI-1 complexed with a synthetic pRSK1 peptide
2KPK Magi-1 PDZ1
2KPL Magi-1 PDZ1 / E6CT

Browse structure collections

About this viewer

MolViewer shows 2R4H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.