A novel DNA recognition mode by nf-kb P65 homodimer. Determined by X-ray diffraction at 2.4 Å resolution. Released 27 May 1998.
Explore 2RAM in 3D Show helices and sheets RCSB PDB PDBe
2RAM contains 27 α-helices and 57 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 20-25 | 6 | 1 |
| α-helix | 26 | 1 | |
| β-strand | 27 | 1 | 2 |
| α-helix | 28 | 1 | |
| α-helix | 32-34 | 3 | |
| β-strand | 35-36 | 2 | 3 |
| α-helix | 46-47 | 2 | |
| β-strand | 48 | 1 | 2 |
| β-strand | 60-64 | 5 | 1 |
| β-strand | 71-78 | 8 | 4 |
| α-helix | 84 | 1 | |
| β-strand | 85 | 1 | 4 |
| α-helix | 86 | 1 | |
| β-strand | 89-91 | 3 | 3 |
| β-strand | 95-96 | 2 | 4 |
| β-strand | 99-103 | 5 | 4 |
| α-helix | 104-105 | 2 | |
| β-strand | 110-112 | 3 | 1 |
| β-strand | 117-120 | 4 | 3 |
| α-helix | 121-122 | 2 | |
| α-helix | 126-135 | 10 | |
| β-strand | 156-166 | 11 | 4 |
| β-strand | 172-174 | 3 | 4 |
| β-strand | 178-179 | 2 | 4 |
| α-helix | 181-182 | 2 | |
| β-strand | 183-184 | 2 | 4 |
| α-helix | 192-194 | 3 | |
| β-strand | 196-199 | 4 | 5 |
| β-strand | 203-205 | 3 | 6 |
| β-strand | 211-216 | 6 | 5 |
| β-strand | 225-230 | 6 | 6 |
| β-strand | 233-236 | 4 | 6 |
| β-strand | 238 | 1 | 5 |
| α-helix | 241-243 | 3 | |
| β-strand | 244 | 1 | 5 |
| β-strand | 249-253 | 5 | 5 |
| α-helix | 254-256 | 3 | |
| β-strand | 266-274 | 9 | 6 |
| α-helix | 275-277 | 3 | |
| β-strand | 279-280 | 2 | 6 |
| α-helix | 281-283 | 3 | |
| β-strand | 284-289 | 6 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 20-25 | 6 | 7 |
| α-helix | 26 | 1 | |
| β-strand | 27 | 1 | 8 |
| α-helix | 28 | 1 | |
| α-helix | 33-34 | 2 | |
| β-strand | 35-36 | 2 | 9 |
| α-helix | 37-39 | 3 | |
| α-helix | 46-47 | 2 | |
| β-strand | 48 | 1 | 8 |
| β-strand | 60-64 | 5 | 7 |
| β-strand | 70-77 | 8 | 10 |
| β-strand | 85 | 1 | 10 |
| β-strand | 89-91 | 3 | 9 |
| β-strand | 95-96 | 2 | 10 |
| β-strand | 99-102 | 4 | 10 |
| β-strand | 110-112 | 3 | 7 |
| β-strand | 117-120 | 4 | 9 |
| α-helix | 126-135 | 10 | |
| β-strand | 156-157 | 2 | 11 |
| β-strand | 158-166 | 9 | 10 |
| β-strand | 172-174 | 3 | 10 |
| α-helix | 175-177 | 3 | |
| β-strand | 178-179 | 2 | 10 |
| α-helix | 180-181 | 2 | |
| β-strand | 183-184 | 2 | 11 |
| α-helix | 193-194 | 2 | |
| β-strand | 196-199 | 4 | 12 |
| β-strand | 203-205 | 3 | 13 |
| β-strand | 211-216 | 6 | 12 |
| β-strand | 220 | 1 | 14 |
| β-strand | 223 | 1 | 14 |
| β-strand | 225-230 | 6 | 13 |
| β-strand | 233-236 | 4 | 13 |
| β-strand | 238 | 1 | 12 |
| α-helix | 241-243 | 3 | |
| β-strand | 244-245 | 2 | 12 |
| β-strand | 249-253 | 5 | 12 |
| α-helix | 254-256 | 3 | |
| β-strand | 266-274 | 9 | 13 |
| β-strand | 279-280 | 2 | 13 |
| α-helix | 281-283 | 3 | |
| β-strand | 284-289 | 6 | 13 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| DNA (5'-D(*CP*GP*GP*CP*TP*GP*GP*AP*AP*AP*TP*(5IU)P*(5IU)P*CP*CP*AP*GP*CP*CP*G)-3') | C, D | DNA | 20 | ||
| Protein (transcription factor nf-kb P65) | A, B | protein | 273 | Mus musculus | Q04207 (AlphaFold model) |
>2RAM_1 DNA (5'-D(*CP*GP*GP*CP*TP*GP*GP*AP*AP*AP*TP*(5IU)P*(5IU)P*CP*CP*AP*GP*CP*CP*G)-3') (chains C, D) CGGCTGGAAATUUCCAGCCG
>2RAM_2 PROTEIN (TRANSCRIPTION FACTOR NF-KB P65) (chains A, B) PYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVT KDPPHRPHPHELVGKDCRDGYYEADLCPDRSIHSFQNLGIQCVKKRDLEQAISQRIQTNN NPFHVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLLLTPVLSHPIFDNRAPNTAELKICR VNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYA DPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPD
| ID | Name | Formula | Copies |
|---|---|---|---|
| DTV | (2S,3S)-1,4-dimercaptobutane-2,3-diol | C4 H10 O2 S2 | 2 |
A novel DNA recognition mode by the NF-kappa B p65 homodimer. Chen, Y.Q., Ghosh, S., Ghosh, G. Nat Struct Biol (1998) 5:67-73. DOI 10.1038/nsb0198-67 · PubMed
Other PDB entries of the same protein (UniProt Q04207 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2RAM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.