2RC4: HAT domain of the human MOZ protein

Name: PDB 2RC4: Crystal Structure of the HAT domain of the human MOZ protein
Published: 2007-11-13
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transferase

Crystal Structure of the HAT domain of the human MOZ protein. Determined by X-ray diffraction at 3.0 Å resolution. Released 13 Nov 2007.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,157
Mol. weight: 34.9 kDa
Ligands: ACO, ZN
Released: 13 Nov 2007

Explore 2RC4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2RC4 contains 9 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	511-513	3	1
β-strand	518-520	3	1
α-helix	529-532	4
β-strand	536-538	3	1
α-helix	550-555	6
β-strand	568-573	6	2
β-strand	576-582	7	2
α-helix	587-598	12
β-strand	613-622	10	2
β-strand	625-635	11	2
β-strand	644	1	3
β-strand	646-649	4	2
α-helix	651-653	3
α-helix	658-671	14
β-strand	679	1	3
α-helix	685-704	20
α-helix	724-732	9
α-helix	751-761	11
α-helix	771-773	3
β-strand	774	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Histone acetyltransferase MYST3	A	protein	287	Homo sapiens	Q92794 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2RC4_1 Histone acetyltransferase MYST3 (chains A)
PPDPQVRCPSVIEFGKYEIHTWYSSPYPQEYSRLPKLYLCEFCLKYMKSRTILQQHMKKC
GWFHPPANEIYRKNNISVFEVDGNVSTIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTQ
NDVKGCHLVGYFSKEKHCQQKYNVSCIMILPQYQRKGYGRFLIDFSYLLSKREGQAGSPE
KPLSDLGRLSYMAYWKSVILECLYHQNDKQISIKKLSKLTGICPQDITSTLHHLRMLDFR
SDQFVRRRREKLIQDHMAKLQLNLRPVDVDPECLRWTPVIVSNSKKK

Ligands and cofactors

ID	Name	Formula	Copies
ACO	Acetyl coenzyme *a	C23 H38 N7 O17 P3 S	1
ZN	Zinc ion	Zn	1

Primary citation

The human monocytic leukemia zinc finger histone acetyltransferase domain contains DNA-binding activity implicated in chromatin targeting. Holbert, M.A., Sikorski, T., Carten, J. et al. J Biol Chem (2007) 282:36603-36613. DOI 10.1074/jbc.M705812200 · PubMed

Other PDB entries of the same protein (UniProt Q92794 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5B78 1.4 Å, Crystal structure of MOZ double PHD finger mutant-S210D/N235R in complex with histone H3…
3V43 1.47 Å, Crystal structure of MOZ
7Y43 1.5 Å, Crystal structure of the KAT6A WH domain and its bound double stranded DNA
5B77 1.55 Å, Crystal structrue of MOZ double PHD finger in complex with histone H3 propionylation at…
4LK9 1.6 Å, Crystal Structure of MOZ double PHD finger histone H3 tail complex
4LKA 1.61 Å, Crystal Structure of MOZ double PHD finger histone H3K9ac complex
5B76 1.65 Å, Crystal structure of MOZ double PHD finger domain in complex with histone H3…
5B75 1.7 Å, Crystal structure of MOZ double PHD finger in complex with histone H3 butyrylation at K14
9DZN 1.72 Å, KAT6A MYST domain complexed with a H3K14-CoA bisubstrate inhibitor
8H7A 1.92 Å, Crystal structure of the dimer form KAT6A WH domain with its bound double stranded DNA
6LSB 2.0 Å, Crystal Structure of DPF domain of MOZ in complex with H3K14bz peptide
9ARR 2.1 Å, Crystal structure of AF9 YEATS domain in complex with dicrotonylated at K1007 and K1014…

Browse structure collections

About this viewer

MolViewer shows 2RC4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.