2RNZ: Histone acetyltransferase ESA1

Name: PDB 2RNZ: Solution structure of the presumed chromodomain of the yeast histone acetyltransferase, Esa1
Published: 2008-04-29
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transferase

Solution structure of the presumed chromodomain of the yeast histone acetyltransferase, Esa1. Determined by solution NMR. Released 29 Apr 2008.

Method: Solution NMR
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 777
Mol. weight: 11.07 kDa
Released: 29 Apr 2008

Explore 2RNZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2RNZ contains 2 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	18-20	3
β-strand	25-30	6	1
β-strand	35-44	10	1
β-strand	51-55	5	1
β-strand	65-68	4	1
β-strand	72	1	1
α-helix	77-79	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Histone acetyltransferase ESA1	A	protein	94	Saccharomyces cerevisiae	Q08649 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2RNZ_1 Histone acetyltransferase ESA1 (chains A)
MGSSHHHHHHSSGLVPRGSHMSVDDIIIKCQCWVQKNDEERLAEILSINTRKAPPKFYVH
YVNYNKRLDEWITTDRINLDKEVLYPKLKATDED

Primary citation

Novel structural and functional mode of a knot essential for RNA binding activity of the Esa1 presumed chromodomain. Shimojo, H., Sano, N., Moriwaki, Y. et al. J Mol Biol (2008) 378:987-1001. DOI 10.1016/j.jmb.2008.03.021 · PubMed

Other PDB entries of the same protein (UniProt Q08649 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3TO7 1.9 Å, Crystal structure of yeast Esa1 HAT domain bound to coenzyme A with active site lysine…
1FY7 2.0 Å, Crystal structure of yeast ESA1 histone acetyltransferase domain complexed with coenzyme a
3TO9 2.0 Å, Crystal structure of yeast Esa1 E338Q HAT domain bound to coenzyme A with active site…
3TO6 2.1 Å, Crystal structure of yeast Esa1 HAT domain complexed with H4K16CoA bisubstrate inhibitor
1MJA 2.26 Å, Crystal structure of yeast Esa1 histone acetyltransferase domain complexed with acetyl…
1MJ9 2.5 Å, Crystal structure of yeast Esa1(C304S) mutant complexed with Coenzyme A
1MJB 2.5 Å, Crystal structure of yeast Esa1 histone acetyltransferase E338Q mutant complexed with…
5J9T 2.7 Å, Crystal structure of the NuA4 core complex
5J9W 2.8 Å, Crystal structure of the NuA4 core complex
5J9U 2.95 Å, Crystal structure of the NuA4 core complex
5J9Q 3.25 Å, Crystal structure of the NuA4 core complex
7VVU 3.4 Å, NuA4 HAT module bound to the nucleosome

Browse structure collections

About this viewer

MolViewer shows 2RNZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.