2RO1: Human KAP1 PHD finger-bromodomain

NMR Solution Structures of Human KAP1 PHD finger-bromodomain. Determined by solution NMR. Released 20 May 2008.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,471
Mol. weight: 21.17 kDa
Ligands: ZN
Released: 20 May 2008

Explore 2RO1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2RO1 contains 5 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	628	1	1
β-strand	646	1	1
α-helix	698-713	16
α-helix	717-721	5
α-helix	740-748	9
α-helix	758-775	18
α-helix	783-799	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription intermediary factor 1-beta	A	protein	189	Homo sapiens	Q13263 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2RO1_1 Transcription intermediary factor 1-beta (chains A)
SATICRVCQKPGDLVMCNQCEFCFHLDCHLPALQDVPGEEWSCSLCHVLPDLKEEDGSLS
LDGADSTGVVAKLSPANQRKCERVLLALFCHEPCRPLHQLATDSTFSLDQPGGTLDLTLI
RARLQEKLSPPYSSPQEFAQDVGRMFKQFNKLTEDKADVQSIIGLQRFFETRMNEAFGDT
KFSAVLVEP

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Structural insights into human KAP1 PHD finger-bromodomain and its role in gene silencing. Zeng, L., Yap, K.L., Ivanov, A.V. et al. Nat Struct Mol Biol (2008) 15:626-633. DOI 10.1038/nsmb.1416 · PubMed

Other PDB entries of the same protein (UniProt Q13263 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9OSC 1.77 Å, Crystal structure of HP1gamma chromoshadow domain in complex with KAP1 peptide
2YVR 1.8 Å, Crystal structure of MS1043
9CDW 2.4 Å, Crystal structure of HP1alpha chromoshadow domain in complex with KAP1 peptide
7Z36 2.8 Å, Crystal structure of the KAP1 tripartite motif in complex with the ZNF93 KRAB domain
6QAJ 2.9 Å, Structure of the tripartite motif of KAP1/TRIM28
6QU1 3.7 Å, Crystal structure of the KAP1 RBCC domain in complex with the SMARCAD1 CUE1 domain at…
6H3A 5.5 Å, Crystal structure of the KAP1 RBCC domain in complex with the SMARCAD1 CUE1 domain.
1FP0 Solution structure of the phd domain from the kap-1 corepressor
6I9H Solution structure of TRIM28 RING domain

Browse structure collections

About this viewer

MolViewer shows 2RO1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.