2YVR: MS1043

Crystal structure of MS1043. Determined by X-ray diffraction at 1.8 Å resolution. Released 15 Apr 2008.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 841
Mol. weight: 12.16 kDa
Ligands: ZN
Released: 15 Apr 2008

Explore 2YVR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2YVR contains 2 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 1 helix, 5 β-strands

Element	Residues	Length	Sheet
β-strand	8	1	1
β-strand	16	1	1
β-strand	19-21	3	2
β-strand	26-28	3	2
α-helix	30-34	5
β-strand	42-44	3	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription intermediary factor 1-beta	A, B	protein	50	Homo sapiens	Q13263 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2YVR_1 Transcription intermediary factor 1-beta (chains A, B)
RDGERTVYCNVHKHEPLVLFCESCDTLTCRDCQLNAHKDHQYQFLEDAVR

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	4

Primary citation

Crystal structure of MS1043. Wang, H., Kishishita, S., Takemoto, C. et al. To be published.

Other PDB entries of the same protein (UniProt Q13263 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9OSC 1.77 Å, Crystal structure of HP1gamma chromoshadow domain in complex with KAP1 peptide
9CDW 2.4 Å, Crystal structure of HP1alpha chromoshadow domain in complex with KAP1 peptide
7Z36 2.8 Å, Crystal structure of the KAP1 tripartite motif in complex with the ZNF93 KRAB domain
6QAJ 2.9 Å, Structure of the tripartite motif of KAP1/TRIM28
6QU1 3.7 Å, Crystal structure of the KAP1 RBCC domain in complex with the SMARCAD1 CUE1 domain at…
6H3A 5.5 Å, Crystal structure of the KAP1 RBCC domain in complex with the SMARCAD1 CUE1 domain.
1FP0 Solution structure of the phd domain from the kap-1 corepressor
2RO1 NMR Solution Structures of Human KAP1 PHD finger-bromodomain
6I9H Solution structure of TRIM28 RING domain

Browse structure collections

About this viewer

MolViewer shows 2YVR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.