6I9H: TRIM28 RING domain

Solution structure of TRIM28 RING domain. Determined by solution NMR. Released 1 May 2019.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 661
Mol. weight: 9.81 kDa
Ligands: ZN
Released: 1 May 2019

Explore 6I9H in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6I9H contains 3 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	55-56	2	1
α-helix	58-60	3
β-strand	64	1	2
β-strand	71	1	2
α-helix	74-76	3
β-strand	78-80	3	3
β-strand	86-88	3	3
α-helix	89-95	7
β-strand	138-139	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription intermediary factor 1-beta	A	protein	94	Homo sapiens	Q13263 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6I9H_1 Transcription intermediary factor 1-beta (chains A)
GPGGAEALELLEHCGVCRERLRPEREPRLLPCLHSACSACLGPAAPAAANSSGDGGAAGD
GTVVDCPVCKQQCFSKDIVENYFMRDSGSKAATD

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Characterisation of class VI TRIM RING domains: linking RING activity to C-terminal domain identity. Stevens, R.V., Esposito, D., Rittinger, K. Life Sci Alliance (2019) 2. DOI 10.26508/lsa.201900295 · PubMed

Other PDB entries of the same protein (UniProt Q13263 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9OSC 1.77 Å, Crystal structure of HP1gamma chromoshadow domain in complex with KAP1 peptide
2YVR 1.8 Å, Crystal structure of MS1043
9CDW 2.4 Å, Crystal structure of HP1alpha chromoshadow domain in complex with KAP1 peptide
7Z36 2.8 Å, Crystal structure of the KAP1 tripartite motif in complex with the ZNF93 KRAB domain
6QAJ 2.9 Å, Structure of the tripartite motif of KAP1/TRIM28
6QU1 3.7 Å, Crystal structure of the KAP1 RBCC domain in complex with the SMARCAD1 CUE1 domain at…
6H3A 5.5 Å, Crystal structure of the KAP1 RBCC domain in complex with the SMARCAD1 CUE1 domain.
1FP0 Solution structure of the phd domain from the kap-1 corepressor
2RO1 NMR Solution Structures of Human KAP1 PHD finger-bromodomain

Browse structure collections

About this viewer

MolViewer shows 6I9H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.