2RQA: LGP2 CTD

Solution structure of LGP2 CTD. Determined by solution NMR. Released 5 May 2009.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,091
Mol. weight: 15.62 kDa
Ligands: ZN
Released: 5 May 2009

Explore 2RQA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2RQA contains 2 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	553-556	4	1
β-strand	564-565	2	1
β-strand	569-572	4	2
β-strand	576-579	4	2
α-helix	583-586	4
β-strand	588	1	3
β-strand	605-606	2	2
β-strand	611	1	4
β-strand	612	1	3
β-strand	618	1	4
β-strand	621-624	4	2
β-strand	629-632	4	2
β-strand	638-641	4	1
β-strand	647	1	1
β-strand	661	1	2
α-helix	664-671	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ATP-dependent RNA helicase DHX58	A	protein	137	Homo sapiens	Q96C10 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2RQA_1 ATP-dependent RNA helicase DHX58 (chains A)
GPHMQFPVEHVQLLCINCMVAVGHGSDLRKVEGTHHVNVNPNFSNYYNVSRDPVVINKVF
KDWKPGGVISCRNCGEVWGLQMIYKSVKLPVLKVRSMLLETPQGRIQAKKWSRVPFSVPD
FDFLQHCAENLSDLSLD

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Primary citation

Solution Structures of Cytosolic RNA Sensor MDA5 and LGP2 C-terminal Domains: IDENTIFICATION OF THE RNA RECOGNITION LOOP IN RIG-I-LIKE RECEPTORS. Takahasi, K., Kumeta, H., Tsuduki, N. et al. J Biol Chem (2009) 284:17465-17474. DOI 10.1074/jbc.M109.007179 · PubMed

Other PDB entries of the same protein (UniProt Q96C10 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3EQT 2.0 Å, Crystal structure of human LGP2 C-terminal domain in complex with dsRNA
2W4R 2.6 Å, Crystal structure of the regulatory domain of human LGP2
9LOV 3.07 Å, LGP2:MDA5:dsRNA filament
9LOU 3.36 Å, LGP2:dsRNA complex

Browse structure collections

About this viewer

MolViewer shows 2RQA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.