2RRU: Sequestosome-1

Solution structure of the UBA omain of p62 and its interaction with ubiquitin. Determined by solution NMR. Released 29 Jun 2011.

Method: Solution NMR
Organism: Mus musculus
Chains: 1
Atoms: 407
Mol. weight: 5.82 kDa
Released: 29 Jun 2011

Explore 2RRU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2RRU contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	9-21	13
α-helix	33-36	4
α-helix	44-46	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sequestosome-1	A	protein	53	Mus musculus	Q64337 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2RRU_1 Sequestosome-1 (chains A)
GPLGSEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKH

Primary citation

Crystal structure of the UBA omain of p62 and its interaction with ubiquitin. Isogai, S., Morimoto, D., Arita, K. et al. To be published.

Other PDB entries of the same protein (UniProt Q64337 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3B0F 1.4 Å, Crystal structure of the UBA domain of p62 and its interaction with ubiquitin
2ZJD 1.56 Å, Crystal Structure of LC3-p62 complex
9W2N 1.67 Å, Crystal structure of the mutant LC3B in complex with p62
3WDZ 2.6 Å, Crystal Structure of Keap1 in Complex with phosphorylated p62
3ADE 2.8 Å, Crystal Structure of Keap1 in Complex with Sequestosome-1/p62

Browse structure collections

About this viewer

MolViewer shows 2RRU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.