2SGF: Streptogrisin B

Phe 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase B. Determined by X-ray diffraction at 1.75 Å resolution. Released 26 Aug 2003.

Method: X-ray diffraction
Resolution: 1.75 Å
Organisms: Streptomyces griseus, Meleagris gallopavo
Chains: 2
Atoms: 1,872
Mol. weight: 24.37 kDa
Ligands: PO4
Released: 26 Aug 2003

Explore 2SGF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2SGF contains 4 α-helices and 24 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain E: 2 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	18	1	1
β-strand	30-32	3	2
β-strand	41-43	3	2
β-strand	46-48B	5	2
β-strand	49-54	6	2
α-helix	56-59	4
β-strand	65-67	3	2
β-strand	84-93	9	2
β-strand	100	1	3
β-strand	103-108	6	2
β-strand	118-119	2	1
β-strand	122-123	2	1
β-strand	126-127	2	3
β-strand	135-140	6	3
β-strand	156-170	15	3
β-strand	176-183	8	3
β-strand	198-201	4	3
β-strand	208-219	12	3
β-strand	223-230	8	3
α-helix	231-237	8
β-strand	240-241	2	2

Chain I: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	16-17	2	3
β-strand	20	1	2
β-strand	23-25	3	4
α-helix	29	1
β-strand	30-31	2	4
α-helix	34-43	10
β-strand	50-53	4	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Streptogrisin B	E	protein	185	Streptomyces griseus	P00777 (AlphaFold model)
Ovomucoid	I	protein	51	Meleagris gallopavo	P68390 (AlphaFold model)

Sequence of entity 1 (E), FASTA

>2SGF_1 Streptogrisin B (chains E)
ISGGDAIYSSTGRCSLGFNVRSGSTYYFLTAGHCTDGATTWWANSARTTVLGTTSGSSFP
NNDYGIVRYTNTTIPKDGTVGGQDITSAANATVGMAVTRRGSTTGTHSGSVTALNATVNY
GGGDVVYGMIRTNVCAEPGDSGGPLYSGTRAIGLTSGGSGNCSSGGTTFFQPVTEALSAY
GVSVY

Sequence of entity 2 (I), FASTA

>2SGF_2 Ovomucoid (chains I)
VDCSEYPKPACTFEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	1

Primary citation

Recruitment of a Buried K+ Ion to Stabilize the Negative Charge of Ionized P1 in the Hydrophobic Pocket: Crystal Structures of Glu18, Gln18, Asp18 and Asn18 Variants of Turkey Ovomucoid Inhibitor Third Domain Complexed with Streptomyces griseus Protease B at Various pHs. Huang, K., Lu, W., Anderson, S. et al. To be published.

Other PDB entries of the same protein (UniProt P00777 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2QA9 1.18 Å, Crystal structure of the second tetrahedral intermediates of SGPB at pH 4.2
2QAA 1.23 Å, Crystal structure of the second tetrahedral intermediates of SGPB at pH 7.3
1SGP 1.4 Å, Ala 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces…
1CT4 1.6 Å, Crystal structure of the OMTKY3 P1 variant OMTKY3-VAL18I in complex with sgpb
1CT2 1.65 Å, Crystal structure of the OMTKY3 P1 variant OMTKY3-THR18I in complex with sgpb
2NU2 1.65 Å, Accommodation of positively-charged residues in a hydrophobic specificity pocket:…
1DS2 1.7 Å, Crystal structure of SGPB:OMTKY3-coo-LEU18I
2GKV 1.7 Å, Crystal structure of the SGPB:P14'-Ala32 OMTKY3-del(1-5) complex
2NU4 1.75 Å, Accommodation of positively-charged residues in a hydrophobic specificity pocket:…
1CT0 1.8 Å, Crystal structure of the OMTKY3 P1 variant OMTKY3-SER18I in complex with sgpb
1SGD 1.8 Å, Asp 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces…
1SGE 1.8 Å, Glu 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces…

Browse structure collections

About this viewer

MolViewer shows 2SGF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.