4F5B: Triple mutant Src SH2 domain

Triple mutant Src SH2 domain bound to phosphotyrosine. Determined by X-ray diffraction at 1.57 Å resolution. Released 3 Oct 2012.

Method: X-ray diffraction
Resolution: 1.57 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,007
Mol. weight: 12.96 kDa
Ligands: PTR
Released: 3 Oct 2012

Explore 4F5B in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4F5B contains 5 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	146-148	3
β-strand	152	1	1
α-helix	158-165	8
α-helix	171	1
β-strand	174-179	6	1
β-strand	187-195	9	1
β-strand	199-207	9	1
β-strand	208-209	2	2
β-strand	215-216	2	2
β-strand	222-223	2	2
α-helix	226-235	10
β-strand	246-247	2	1
α-helix	248-249	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Proto-oncogene tyrosine-protein kinase Src	A	protein	112	Homo sapiens	P12931 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4F5B_1 Proto-oncogene tyrosine-protein kinase Src (chains A)
GAMDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETVKGAYALSVSDFDNAKGL
NVKHYLIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPTSK

Ligands and cofactors

ID	Name	Formula	Copies
PTR	O-phosphotyrosine	C9 H12 N O6 P	1

Primary citation

Superbinder SH2 Domains Act as Antagonists of Cell Signaling. Kaneko, T., Huang, H., Cao, X. et al. Sci Signal (2012) 5:ra68-ra68. DOI 10.1126/scisignal.2003021 · PubMed

Other PDB entries of the same protein (UniProt P12931 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9OFX 1.45 Å, Crystal structure of c-Src SH3 domain in H32 space group mediated by nickel
1FMK 1.5 Å, Crystal structure of human tyrosine-protein kinase C-src
1O43 1.5 Å, Crystal structure of SH2 in complex with RU82129.
1O4A 1.5 Å, Crystal structure of SH2 in complex with RU82197.
1O4R 1.5 Å, Crystal structure of SH2 in complex with RU78783.
2SRC 1.5 Å, Crystal structure of human tyrosine-protein kinase C-src, in complex with AMP-pnp
6C4S 1.5 Å, Human cSrc SH3 Domain in complex with Choline Kinase fragment 60-69
7NG7 1.5 Å, Src kinase bound to eCF506 trapped in inactive conformation
8VCF 1.5 Å, Crystal structure of Superbinder Src SH2 domain with Cysteine to Serine mutations
1O48 1.55 Å, Crystal structure of SH2 in complex with RU85053.
1O4G 1.55 Å, Crystal structure of SH2 in complex with DPI59.
1O4K 1.57 Å, Crystal structure of SH2 in complex with pasbn.

Browse structure collections

About this viewer

MolViewer shows 4F5B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.