2UZ8: PDB entry 2UZ8

The crystal structure of p18, human translation elongation factor 1 epsilon 1. Determined by X-ray diffraction at 2.0 Å resolution. Released 25 Mar 2008.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 2,793
Mol. weight: 40.33 kDa
Released: 25 Mar 2008

Explore 2UZ8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2UZ8 contains 24 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	2-13	12
α-helix	19-21	3
β-strand	23-25	3	1
β-strand	30-34	5	1
β-strand	40-42	3	1
α-helix	44-54	11
α-helix	58-61	4
α-helix	65-77	13
α-helix	78-82	5
α-helix	90-101	12
α-helix	102-104	3
α-helix	115-128	14
α-helix	133-138	6
α-helix	140-151	12
α-helix	160-163	4

Chain B: 12 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	3-13	11
α-helix	19-21	3
β-strand	22-25	4	2
β-strand	30-34	5	2
β-strand	40-42	3	2
α-helix	44-54	11
α-helix	58-61	4
α-helix	65-77	13
α-helix	78-82	5
α-helix	91-101	11
α-helix	102-104	3
α-helix	115-129	15
α-helix	133-138	6
α-helix	140-151	12
α-helix	160-163	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Eukaryotic translation elongation factor 1 epsilon-1	A, B	protein	174	HOMO SAPIENS	O43324 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2UZ8_1 EUKARYOTIC TRANSLATION ELONGATION FACTOR 1 EPSILON-1 (chains A, B)
MAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLMGLTTIAAHLVKQANKEYL
LGSTAEEKAMVQQWLEYRVTQVDGHSSKNDIHTLLMDLNSYLEDKVYLTGYNFTLADILL
YYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKNRLYTNSH

Primary citation

Determination of Three-Dimensional Structure and Residues of the Novel Tumor Suppressor Aimp3/P18 Required for the Interaction with Atm. Kim, K.J., Park, M.C., Choi, S.J. et al. J Biol Chem (2008) 283:14032. DOI 10.1074/JBC.M800859200 · PubMed

Other PDB entries of the same protein (UniProt O43324 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4BVX 1.6 Å, Crystal structure of the AIMP3-MRS N-terminal domain complex with I3C
4BL7 1.89 Å, Crystal structure of the AIMP3-MRS N-terminal domain complex in different space group
4BVY 1.99 Å, Crystal structure of the AIMP3-MRS N-terminal domain complex
5BMU 2.6 Å, The crystal structure of the GST-like domains complex of AIMP3-EPRS mutant C92SC105SC123S
5Y6L 2.9 Å, A subcomplex crystal structure of human cytosolic aspartyl-tRNA synthetase and…

Browse structure collections

About this viewer

MolViewer shows 2UZ8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.