4BVX: AIMP3-MRS N-terminal domain complex with I3C

Crystal structure of the AIMP3-MRS N-terminal domain complex with I3C. Determined by X-ray diffraction at 1.6 Å resolution. Released 16 Jul 2014.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 3,247
Mol. weight: 45.22 kDa
Ligands: I3C
Released: 16 Jul 2014

Explore 4BVX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4BVX contains 26 α-helices and 9 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	1
α-helix	12-18	7
α-helix	19-22	4
β-strand	29-32	4	1
β-strand	50-52	3	1
β-strand	58-59	2	1
α-helix	62-72	11
α-helix	79-87	9
α-helix	88-92	5
α-helix	93-104	12
α-helix	111-114	4
α-helix	115-117	3
α-helix	118-130	13
α-helix	143-156	14
α-helix	159-161	3
α-helix	167-177	11
α-helix	180-190	11
α-helix	194-198	5
α-helix	199-202	4

Chain B: 11 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	3-14	12
β-strand	22-25	4	2
β-strand	30-34	5	2
β-strand	40-42	3	2
α-helix	44-54	11
α-helix	58-61	4
α-helix	65-77	13
α-helix	78-82	5
α-helix	85-101	17
α-helix	102-104	3
β-strand	107	1	3
β-strand	110	1	3
α-helix	115-128	14
α-helix	133-138	6
α-helix	140-151	12
α-helix	160-163	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Methionine--tRNA ligase, cytoplasmic	A	protein	215	HOMO SAPIENS	P56192 (AlphaFold model)
Eukaryotic translation elongation factor 1 epsilon-1	B	protein	171	HOMO SAPIENS	O43324 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4BVX_1 METHIONINE--TRNA LIGASE, CYTOPLASMIC (chains A)
MRLFVSDGVPGCLPVLAAAGRARGRAEVLISTVGPQDCVVPFLTRPKVPVLQLDSGNYLF
STSAICRYFFLLSGWEQDDLTNQWLEWEATELQPALSAALYYLVVQGKKGEDVLGSVRRA
LTHIDHSLSRQNCPFLAGETESLADIVLWGALYPLLQDPAYLPEELSALHSWFQTLSTQE
PCQRAAQTVLKQQGVLALRPYLQKQPQLEHHHHHH

Sequence of entity 2 (B), FASTA

>4BVX_2 EUKARYOTIC TRANSLATION ELONGATION FACTOR 1 EPSILON-1 (chains B)
GHMAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNDGPSLMGLTTIAAHLVKQANKE
YLLGSTAEEKAMVQQWLEYRVTQVDGHSSKNDIHTLLMDLNSYLEDKVYLTGYNFTLADI
LLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKNRL

Ligands and cofactors

ID	Name	Formula	Copies
I3C	5-amino-2,4,6-triiodobenzene-1,3-dicarboxylic acid	C8 H4 I3 N O4	3

Primary citation

Assembly of Multi-tRNA Synthetase Complex Via Heterotetrameric Glutathione Transferase-Homology Domains. Cho, H.Y., Maeng, S.J., Cho, H.J. et al. J Biol Chem (2015) 290:29313. DOI 10.1074/JBC.M115.690867 · PubMed

Other PDB entries of the same protein (UniProt P56192 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4BL7 1.89 Å, Crystal structure of the AIMP3-MRS N-terminal domain complex in different space group
4BVY 1.99 Å, Crystal structure of the AIMP3-MRS N-terminal domain complex
5GL7 2.01 Å, Crystal structure of a truncated human cytosolic methionyl-tRNA synthetase
5GOY 2.28 Å, The crystal structure of human cytosolic methionyl-tRNA synthetase in complex with…
5Y6L 2.9 Å, A subcomplex crystal structure of human cytosolic aspartyl-tRNA synthetase and…
2DJV Solution structures of the WHEP-TRS domain of human methionyl-tRNA synthetase

Browse structure collections

About this viewer

MolViewer shows 4BVX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.